Bioquímicos e reagentes

<p>Mouse monoclonal OSBPL11 antibody</p>

<p>MRPS18B antibody was raised in Rabbit using Human MRPS18B as the immunogen</p>

<p>Affinity purified Rabbit polyclonal CMG1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FAM71A antibody, catalog no. 70R-4190</p>

<p>Rabbit polyclonal STOML2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ERCC8 antibody, catalog no. 70R-2728</p>

<p>Phosphothreonine antibody (biotin) was raised in rabbit using phosphothreonine-KLH and phosvitin mixture as the immunogen.</p>

<p>GLUT10 antibody was raised in rabbit using residues 367-385 (ILSTAKKTKPHPRSGDPSA) of the human, mouse and rat GLUT10 protein as the immunogen.</p>

<p>The TDG antibody is a polyclonal antibody that specifically targets VEGF (vascular endothelial growth factor). It is widely used in life sciences research to study endogenous hematopoietic processes, insulin signaling pathways, and various other biological processes. This antibody has been shown to have high affinity and specificity for VEGF and can be used in various experimental techniques such as ELISA, Western blotting, immunohistochemistry, and flow cytometry.</p>

<p>ZNF429 antibody was raised in rabbit using the N terminal of ZNF429 as the immunogen</p>

<p>The CBR1 antibody is a polyclonal antibody that is used in Life Sciences research. It is activated and can be used to study the effects of various biomolecules on CBR1 activity. This antibody has been shown to neutralize the activity of teriparatide, interleukin-6, haloperidol, droperidol, dopamine, interferon, and TNF-α. By binding to CBR1, this antibody can inhibit the formation of protein complexes involved in various cellular processes. It is a valuable tool for researchers studying the role of CBR1 in different biological pathways and can provide insights into potential therapeutic targets.</p>

<p>Transferrin antibody is a monoclonal antibody that specifically targets and neutralizes transferrin, a protein complex involved in the transport of iron in the body. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications. It has the ability to bind to transferrin with high affinity, preventing its interaction with receptors and inhibiting iron uptake by cells. This can be particularly useful in conditions where excessive iron accumulation is detrimental, such as certain types of cancer or neurodegenerative diseases. Additionally, transferrin antibody has been explored for its potential use in diagnostic assays, as it can detect and quantify transferrin levels in biological samples. Its unique properties make it a valuable tool for researchers working on understanding the role of transferrin and its associated pathways in health and disease.</p>

<p>ACTH N-Terminal Monoclonal Antibody - Recombinant</p>

<p>EPB41 antibody was raised using a synthetic peptide corresponding to a region with amino acids QVAEGGVLDASAKKTVVPKAQKETVKAEVKKEDEPPEQAEPEPTEAWKKK</p>

<p>Purified recombinant POLR2C protein (His tag)</p>

<p>C17ORF64 antibody was raised using the middle region of C17Orf64 corresponding to a region with amino acids NMQTPGQGSPLPGQPRSQDHVKKDSLRELSQKPKLKRKRIKEAPETPETE</p>

<p>Ketamine antibody is a monoclonal antibody that specifically targets sclerostin, a protein involved in bone metabolism. This antibody can be used in various assays to detect and quantify sclerostin levels in biological samples. The high specificity and sensitivity of this antibody make it an ideal tool for research in the field of bone biology and related diseases. Additionally, the colloidal gold conjugation of this antibody allows for easy visualization and detection in immunoassays. Whether you are studying the role of sclerostin in osteoporosis or investigating potential therapeutic interventions, this ketamine antibody is an essential tool for your research.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FAM71D antibody, catalog no. 70R-4980</p>

<p>Affinity purified Rabbit polyclonal Lipoic acid synthetase antibody</p>

<p>The Cryptosporidium Antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody specifically targets and neutralizes the growth factor insulin, as well as tumor necrosis factor-alpha (TNF-α). It has been extensively tested and proven effective in various research applications.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PFDN2 antibody, catalog no. 70R-9434</p>

<p>Rabbit polyclonal TREF1 antibody</p>

<p>KLHL11 antibody was raised in Mouse using a purified recombinant fragment of human KLHL11 expressed in E. coli as the immunogen.</p>

<p>SPP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MRIAVICFCLLGITCAIPVKQADSGSSEEKQLYNKYPDAVATWLNPDPSQ</p>

<p>CHSY1 antibody was raised in Rabbit using Human CHSY1 as the immunogen</p>

<p>ERas protein is a growth factor that plays a crucial role in cellular signaling pathways. It contains histidine residues and is available as a recombinant protein for research purposes. ERas protein has been shown to exhibit reactive and cytotoxic properties, making it an important tool in studying cell growth and development. It interacts with various receptors, including the epidermal growth factor receptor and erythropoietin receptor, to regulate important cellular processes. Researchers in the life sciences field can utilize ERas protein for various applications, such as studying signal transduction pathways or developing monoclonal antibodies for targeted therapies. Its versatility and potential make it a valuable resource for advancing scientific knowledge in multiple disciplines.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of VEZF1 antibody, catalog no. 70R-8085</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SPAG8 antibody, catalog no. 70R-2385</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KCNA1 antibody, catalog no. 70R-5148</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections as it contains active compounds with bactericidal activity. Through its mechanism of action, this drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Extensive research has confirmed its efficacy through various techniques like transcription-quantitative polymerase chain and patch-clamp technique. The drug undergoes several metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth. With its impressive properties and proven effectiveness, the 6-Fluoro-3-indoxyl-beta-D</p>

<p>Purified recombinant PURB protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PCBD2 antibody, catalog no. 70R-10089</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NOL6 antibody, catalog no. 70R-1347</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SFN antibody, catalog no. 70R-9288</p>

<p>Rabbit polyclonal hnRNPM antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MCM8 antibody, catalog no. 70R-5553</p>

<p>Rabbit Polyclonal PLEKHA9 antibody</p>

<p>NLK antibody was raised in rabbit using the middle region of NLK as the immunogen</p>

<p>The IL4 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It specifically targets and neutralizes interleukin-4 (IL-4), a glycan involved in various biological processes. This antibody has been extensively studied for its potential therapeutic applications.</p>

<p>Rat monoclonal CD209 antibody (biotin)</p>

<p>NODAL antibody was raised using a synthetic peptide corresponding to a region with amino acids PSSPSPLAYMLSLYRDPLPRADIIRSLQAEDVAVDGQNWTFAFDFSFLSQ</p>

<p>YWHAE antibody was raised in rabbit using the middle region of YWHAE as the immunogen</p>

<p>MAGEA11 antibody was raised in Rabbit using Human MAGEA11 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KIAA1618 antibody, catalog no. 70R-8746</p>

<p>CXCR6 antibody was raised in rabbit using the N terminal of CXCR6 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PSMB2 antibody, catalog no. 70R-2346</p>

<p>The AKT1 antibody is a powerful tool used in Life Sciences research. This antibody specifically targets the AKT1 protein, which plays a crucial role in cell growth, survival, and metabolism. By binding to AKT1, this antibody can effectively block its activity and inhibit downstream signaling pathways.</p>

<p>BDNF antibody was raised in Rabbit using Human BDNF as the immunogen</p>

<p>UBE2K antibody was raised in rabbit using the middle region of UBE2K as the immunogen</p>

<p>Rabbit polyclonal TCF12 antibody</p>

<p>Rabbit Polyclonal Catenin antibody (Ser33)</p>

<p>The LPL antibody is a powerful inhibitor used in the field of Life Sciences. It is specifically designed to target and neutralize the activity of lipoprotein lipase (LPL), an enzyme involved in lipid metabolism. This antibody has been extensively studied and proven to effectively block LPL function, making it a valuable tool for researchers studying the role of LPL in various biological processes.</p>

<p>Rabbit polyclonal NFKP p65 antibody</p>

<p>MMP13 antibody was raised using a synthetic peptide corresponding to a region with amino acids HFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGET</p>

<p>ELMO2 antibody was raised in Rabbit using Human ELMO2 as the immunogen</p>

<p>The PARP1 antibody is a specific antibody used in Life Sciences research. It binds to PARP1, a protein involved in DNA repair and cell survival. This antibody is commonly used to study the role of PARP1 in various cellular processes, including DNA damage response and apoptosis. The PARP1 antibody can be used for immunofluorescence, immunoprecipitation, Western blotting, and other experimental techniques. It has been validated for use in both human and animal samples. Researchers can use this antibody to gain insights into the molecular mechanisms underlying diseases such as cancer and neurodegenerative disorders. With its high specificity and sensitivity, the PARP1 antibody is an essential tool for scientists studying growth factors, oncogenic kinases, and the development of targeted therapies such as trastuzumab or PARP inhibitors.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MMEL1 antibody, catalog no. 70R-6249</p>

<p>Goat anti-bovine IgG (biotin) was raised in goat using bovine IgG F(ab')2 fragment as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HSPA4L antibody, catalog no. 70R-3945</p>

<p>PPP5C antibody was raised using the N terminal of PPP5C corresponding to a region with amino acids MAMAEGERTECAEPPRDEPPADGALKRAEELKTQANDYFKAKDYENAIKF</p>

<p>Zilpaterol Conjugate for use in immunoassays</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MRM1 antibody, catalog no. 70R-1392</p>

<p>Rabbit polyclonal Casein kinase 2 antibody (FITC)</p>

<p>Pneumocystis carinii antibody was raised in mouse using Pneumocystis carinii isolates as the immunogen.</p>

EXOC4 antibody was raised in Rabbit using Human EXOC4 as the immunogen

<p>Recombinant human MAF1 protein</p>

<p>NME1 antibody was raised in Mouse using a purified recombinant fragment of human NME1 expressed in E. coli as the immunogen.</p>

<p>Rat monoclonal TIM3 antibody (biotin)</p>

<p>Rabbit Polyclonal eIF4B antibody (Ser422)</p>

<p>TH antibody is a monoclonal antibody that targets the growth factor known as epidermal growth factor (EGF). It specifically binds to EGF and inhibits its activity, making it an effective tool for research in the field of Life Sciences. This antibody has been used in various studies to investigate the role of EGF in different biological processes. Additionally, TH antibody has shown neuroprotective properties by reducing dopamine levels in the brain. It can be used in experiments involving electrode recordings or binding protein analysis. Whether you're studying cell signaling pathways or developing new therapeutic approaches, TH antibody is a valuable tool for your research.</p>

<p>The ALDH2 protein is a vital component in Life Sciences. It is commonly used in research and diagnostic applications, particularly in the field of antibodies, Proteins, and Antigens. The ALDH2 protein plays a crucial role in various biological processes, including the metabolism of aldehydes and the regulation of collagen synthesis.</p>

<p>Rabbit polyclonal TTC23 antibody</p>

<p>The AKR1D1 protein is a versatile enzyme that plays a crucial role in various biological processes. It acts as a protein kinase, regulating the activity of other proteins involved in cellular signaling pathways. Additionally, it is involved in the epidermal growth factor (EGF) pathway, which is essential for cell growth and development.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SETDB2 antibody, catalog no. 70R-2104</p>

<p>Rabbit polyclonal GRAK antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RBM26 antibody, catalog no. 70R-4963</p>

<p>ACTH N-Terminal Monoclonal Antibody</p>

<p>Purified Mouse IgG (Fab)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ITPK1 antibody, catalog no. 70R-3684</p>

<p>Purified recombinant KRT5 protein (His tag)</p>

<p>Mouse monoclonal MAPK7 antibody</p>

<p>FAM119A antibody was raised in Rabbit using Human FAM119A as the immunogen</p>

<p>Rabbit polyclonal ENTK antibody</p>

<p>Rabbit polyclonal cRAF antibody (Ser301)</p>

<p>CD3d antibody is a proteolytic antibody that specifically targets CD3d, a surface glycoprotein found on T cells. This antibody plays a crucial role in molecular signaling and activation of T cells, which are important components of the immune system. CD3d antibody has been extensively studied in the field of life sciences and has shown promising results in various applications.</p>

<p>Rabbit polyclonal UBE2H antibody</p>

<p>The Annexin A1 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It plays a crucial role in various cellular processes, including hepatocyte growth, epidermal growth factor signaling, and TGF-beta regulation. This antibody has been shown to neutralize the effects of growth factors such as transferrin and promote cellular homeostasis. With its high specificity and affinity for Annexin A1, this antibody can effectively bind to the protein and modulate its activity.</p>

<p>Rabbit polyclonal FOXL1 antibody</p>

<p>Rabbit polyclonal Synaptophysin 2 antibody</p>

<p>METTL4 antibody was raised in Rabbit using Human METTL4 as the immunogen</p>

<p>Affinity purified Rabbit polyclonal Integrin beta 2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C17orf75 antibody, catalog no. 70R-4015</p>

<p>The Alkaline Phosphatase antibody is a highly specialized antibody that targets the phosphatase enzyme. This antibody is widely used in Life Sciences research for various applications, including the detection and quantification of phosphatase activity in biological samples. It can also be used to study the role of phosphatases in signaling pathways, cell differentiation, and disease progression.</p>

<p>Mouse monoclonal SCYL3 antibody</p>

<p>CXORF34 antibody was raised using the middle region of Cxorf34 corresponding to a region with amino acids GAACGLTSLYFQESTMTRCSHQQSPYQLLFGEPYIFEELLSLKIRISPDA</p>

<p>CD72 antibody was raised in rabbit using residues 25-37 [LGQDPGADDDGEI] of the 42 kDa human CD72 protein as the immunogen.</p>

<p>INVS antibody was raised in Rabbit using Human INVS as the immunogen</p>

<p>SMYD2 antibody was raised in rabbit using the N terminal of SMYD2 as the immunogen</p>

<p>Purified Polyclonal DNA Polymerase alpha 1 antibody</p>

<p>Pdyn antibody was raised in rabbit using the middle region of Pdyn as the immunogen</p>

<p>The Homer 3 antibody is a monoclonal antibody that has neutralizing properties against natriuretic, multidrug, growth factor, and hormone peptides. This antibody specifically targets collagen and inhibits its activity. It is widely used in the field of Life Sciences for research purposes. The Homer 3 antibody also plays a role in regulating triglyceride lipase and lipoprotein lipase activities. Additionally, it has been shown to have antibiotic properties against certain bacteria. With its high specificity and effectiveness, the Homer 3 antibody is an essential tool for researchers and scientists in various fields of study.</p>

<p>Rabbit polyclonal CNPY2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MED4 antibody, catalog no. 70R-8934</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of WWP2 antibody, catalog no. 70R-2784</p>

<p>EIF4B antibody was raised using the middle region of EIF4B corresponding to a region with amino acids QTGNSSRGPGDGGNRDHWKESDRKDGKKDQDSRSAPEPKKPEENPASKFS</p>

<p>Purified recombinant SKA1 protein (His tag)</p>

<p>NELL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MESRVLLRTFCLIFGLGAVWGLGVDPSLQIDVLTELELGESTTGVRQVPG</p>

<p>CYP4F11 antibody was raised using the N terminal of CYP4F11 corresponding to a region with amino acids FPQPPKQNWFWGHQGLVTPTEEGMKTLTQLVTTYPQGFKLWLGPTFPLLI</p>

<p>The S6K antibody is a highly specialized product in the field of Life Sciences. It is a polyclonal antibody that specifically targets transferrin, a protein involved in iron transport. This antibody can be used for various applications, such as immunohistochemistry and western blotting. It has been extensively tested and validated to ensure its specificity and sensitivity.</p>

<p>Rabbit polyclonal LAMA5 antibody</p>

TTC5 antibody was raised using the C terminal of TTC5 corresponding to a region with amino acids GDSVAIPEPNLRLHRIQHKGKDYSFSSVRVETPLLLVVNGKPQGSSSQAV

<p>Desmethyllnoproxen Conjugate for use in immunoassays</p>

<p>Purified recombinant Human RCN2 protein</p>

<p>The CA 125 antibody is an immobilized monoclonal antibody that specifically targets the cell antigen CA 125. It has been extensively tested and validated for its high affinity and specificity towards CA 125. This antibody is commonly used in research and diagnostic applications to detect and quantify CA 125 levels in biological samples.</p>

<p>ECH1 antibody was raised in Rabbit using Human ECH1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PSMD3 antibody, catalog no. 70R-9399</p>

<p>Rabbit polyclonal CHRM1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FAH antibody, catalog no. 70R-2625</p>

<p>COQ7 antibody was raised in Rabbit using Human COQ7 as the immunogen</p>

<p>RAB5A antibody was raised using the middle region of RAB5A corresponding to a region with amino acids SFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNS</p>

<p>The GALR3 antibody is a high-quality reagent that belongs to the class of polyclonal antibodies. It specifically targets galanin receptors, which are protein products involved in various biological processes. This antibody is widely used in life sciences research to study the functions and interactions of galanin and its receptors. With its exceptional specificity and sensitivity, the GALR3 antibody is an essential tool for scientists working in the field of galanin receptor research. Whether you are investigating neurobiology, endocrinology, or other related areas, this antibody will provide valuable insights into the role of galanin receptors in various physiological processes. Trust the GALR3 antibody to deliver reliable and reproducible results for your experiments and advance your scientific understanding.</p>

<p>Purified Polyclonal Histone Deacetylase 5 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TAGAP antibody, catalog no. 70R-10417</p>

<p>DUSP15 antibody was raised in Rabbit using Human DUSP15 as the immunogen</p>

<p>ESDN antibody was raised in rabbit using residues 399-416 [QDKIFQGNKDYHKDVRNN] of the human ESDN protein as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of IGFBP2 antibody, catalog no. 70R-5304</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SFRS3 antibody, catalog no. 70R-4718</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DDX5 antibody, catalog no. 70R-1382</p>

<p>Mouse Albumin protein is a highly versatile protein that plays a crucial role in various biological processes. It is composed of disulfide bonds and glutamate residues, which contribute to its stability and function.</p>

<p>Fam55d antibody was raised in rabbit using the C terminal of Fam55d as the immunogen</p>

<p>SPATA16 antibody was raised using the N terminal of SPATA16 corresponding to a region with amino acids MDAGSSRSLENAVNRIYHDQLVPKINTSKKMSTLAHPPNILEMSQEIKKN</p>

<p>Purified native Human FSH protein (intact) (&gt; 99% pure)</p>

<p>HE4 Protein is a versatile biomarker that plays a crucial role in various biological processes. It functions as a natriuretic factor, chemokine, and has been extensively studied in the field of Life Sciences. HE4 Protein is derived from a hybridoma cell line and can be produced as recombinant proteins or chimeric proteins fused with streptavidin or bovine γ-globulin.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SYNGR4 antibody, catalog no. 70R-6866</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FES antibody, catalog no. 70R-5774</p>

<p>ApoBEC3F antibody was raised using the C terminal of APOBEC3F corresponding to a region with amino acids ASVEIMGYKDFKYCWENFVYNDDEPFKPWKGLKYNFLFLDSKLQEILE</p>

<p>DNPEP antibody was raised in Rabbit using Human DNPEP as the immunogen</p>

<p>Affinity purified Rabbit polyclonal PITPN antibody</p>

<p>KCNAB1 antibody was raised in Rabbit using Human KCNAB1 as the immunogen</p>

<p>CASP5 antibody was raised in rabbit using the middle region of CASP5 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of APOE antibody, catalog no. 70R-5264</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KLRC3 antibody, catalog no. 70R-6843</p>

<p>Progesterone 3-CMO is a steroid hormone that plays a crucial role in the female reproductive system. It is commonly used in Life Sciences research for various applications, including antigen-antibody reactions and studying hormone receptor interactions. Progesterone 3-CMO emits a signal that can be detected and measured, making it useful for assays and experiments. This compound is often utilized in conjunction with monoclonal antibodies to detect specific proteins and antigens. Additionally, Progesterone 3-CMO has been found to have neutralizing effects on certain autoantibodies and growth factors like oncostatin. Its activated form can be immobilized on cellulose or other solid supports for easy handling and efficient binding. With its versatility and reliability, Progesterone 3-CMO is an essential tool for researchers in the field of Life Sciences.</p>

<p>AAV4 antibody was raised in rabbit using residues 456-467 [NFTKLRPTNFSNC] of 81 kDa capsid VP3 protein of AAV 4 as the immunogen.</p>

<p>Rabbit polyclonal MAPK10 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ATP6V1G2 antibody, catalog no. 70R-9529</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LIF antibody, catalog no. 70R-6230</p>

<p>MRPSGRKSSK MQAFRIWDVN QKTFYLRNNQ LVAGYLQGPN VNLEEKIDVV PIEPHALFLG IHGGKMCLSC VKSGDETRLQ LEAVNITDLS ENRKQDKRFA FIRSDSGPTT SFESAACPGW FLCTAMEADQ PVSLTNMPDE GVMVTKFYFQ EDE</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of OPN1MW antibody, catalog no. 70R-9882</p>

<p>Purified recombinant Human SLPI protein</p>

<p>ASF1A antibody was raised in rabbit using the N terminal of ASF1A as the immunogen</p>

<p>BXDC2 antibody was raised using the middle region of Bxdc2 corresponding to a region with amino acids ALLKELLIQIFSTPRYHPKSQPFVDHVFTFTILDNRIWFRNFQIIEEDAA</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LOC728566 antibody, catalog no. 70R-9032</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF517 antibody, catalog no. 70R-9029</p>

<p>The EDNRA antibody is a powerful tool in cellular immunotherapy and biomarker research. This polyclonal antibody specifically targets the proline-rich protein expressed by the EDNRA gene. It has been extensively studied and validated using techniques such as cDNA microarray analysis.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SRPR antibody, catalog no. 70R-5029</p>

<p>The c-Jun antibody is a highly specialized biotinylated antibody that is used for various applications in research and diagnostics. This antibody specifically targets the c-Jun protein, which plays a crucial role in cell growth, differentiation, and apoptosis. The c-Jun antibody can be used for immunohistochemistry, Western blotting, ELISA, and other techniques to detect and quantify the presence of c-Jun in different samples.</p>

<p>Rabbit polyclonal IRS1 antibody (Ser312)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TMCO4 antibody, catalog no. 70R-9353</p>

<p>Testosterone-3-HRP</p>

<p>Mestanolone 3 Conjugate for use in immunoassays</p>

<p>Purified homogeneous preparation of Alkaline Phosphatase conjugated Streptavidin protein</p>

<p>Rabbit polyclonal cJun antibody (Ser243)</p>

<p>NAT8 antibody was raised in Rabbit using Human NAT8 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FGF2 antibody, catalog no. 70R-4603</p>

<p>OR2W1 antibody was raised in rabbit using the C terminal of OR2W1 as the immunogen</p>

<p>Rabbit polyclonal PAK2 antibody (Ser20)</p>

<p>Rabbit Polyclonal LKB1 antibody (Ser428)</p>

<p>Claudin 15 antibody was raised using the C terminal of CLDN15 corresponding to a region with amino acids LCSACCCGSDEDPAASARRPYQAPVSVMPVATSDQEGDSSFGKYGRNAYV</p>

<p>Goat anti-human lambda chain (Fab'2) (HRP) was raised in goat using human lambda chain as the immunogen.</p>

<p>GTF2F2 antibody was raised in Rabbit using Human GTF2F2 as the immunogen</p>

<p>GMPPA antibody was raised in Rabbit using Human GMPPA as the immunogen</p>

<p>Rabbit polyclonal TRA2 alpha antibody</p>

<p>ATXN7L1 antibody was raised using the middle region of ATXN7L1 corresponding to a region with amino acids KVPSPEAFLGKPWSSWIDAAKLHCSDNVDLEEAGKEGGKSREVMRLNKED</p>

<p>Purified Polyclonal HP1 alpha antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TSPAN12 antibody, catalog no. 70R-7188</p>

<p>Purified recombinant Human CHMP1B Protein (His tag)</p>

<p>Rabbit polyclonal Met antibody (Tyr1349)</p>

<p>GCSH antibody was raised in Rabbit using Human GCSH as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ITGBL1 antibody, catalog no. 70R-1700</p>

<p>The p53 antibody is a highly specific monoclonal antibody that is used in various research and diagnostic applications. It is designed to target and bind to the p53 protein, which plays a crucial role in regulating cell growth and preventing tumor formation. This antibody can be used for immunohistochemistry, Western blotting, flow cytometry, and other techniques to detect and analyze the expression of p53 in different samples.</p>