Bioquímicos e reagentes

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC17A2 antibody, catalog no. 70R-7000</p>

<p>CIT antibody was raised in Rabbit using Human CIT as the immunogen</p>

<p>Purified Dog IgG FITC conjugate</p>

<p>EZH1 antibody was raised in Rabbit using Human EZH1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KPNA6 antibody, catalog no. 70R-2070</p>

<p>CLPB antibody was raised using a synthetic peptide corresponding to a region with amino acids QGGRFDTKCLAAATWGRLPGPEETLPGQDSWNGVPSRAGLGMCALAAALV</p>

<p>Galectin 3 antibody is an essential tool used in Life Sciences research. It is a polyclonal antibody that specifically targets galectin 3, a protein involved in various biological processes. This antibody has been extensively studied and proven to be effective in neutralizing the activity of galectin 3.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Bbs1 antibody, catalog no. 70R-9518</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ARSA antibody, catalog no. 70R-2332</p>

<p>Purified Rabbit polyclonal OR6J1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PRMT1 antibody, catalog no. 70R-1243</p>

<p>Rabbit polyclonal Histone H2A antibody (Thr121)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GGTL3 antibody, catalog no. 70R-6413</p>

<p>Rabbit polyclonal ARF5 antibody</p>

<p>GALE antibody was raised in rabbit using the middle region of GALE as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ASPH antibody, catalog no. 70R-1844</p>

<p>ZNF284 antibody was raised in rabbit using the middle region of ZNF284 as the immunogen</p>

<p>Rabbit polyclonal U1A antibody (biotin)</p>

<p>NONO antibody was raised using the N terminal of NONO corresponding to a region with amino acids KQNHTPRKHHQHHHQQQHHQQQQQQPPPPPIPANGQQASSQNEGLTIDLK</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C11orf24 antibody, catalog no. 70R-7480</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CEACAM6 antibody, catalog no. 70R-1221</p>

<p>Keratin K6 antibody was raised in Guinea Pig using synthetic peptide of human keratin K6 coupled to KLH as the immunogen.</p>

<p>FHL2 antibody was raised in Rabbit using Human FHL2 as the immunogen</p>

<p>EFCAB4B antibody was raised in Rabbit using Human EFCAB4B as the immunogen</p>

<p>RNPEPL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKPADIGPRSRVWAEPCLLPTATSKLSGAVEQWLSAAERLYGPYMWGRYD</p>

<p>ZNF578 antibody was raised in rabbit using the N terminal of ZNF578 as the immunogen</p>

<p>The PI3K antibody is a powerful tool in the field of Life Sciences. It is used to study the role of phosphoinositide 3-kinase (PI3K) in various cellular processes, including cell growth, proliferation, and survival. This antibody specifically targets and binds to the activated form of PI3K, allowing researchers to analyze its function and activity.</p>

<p>ADPRHL2 antibody was raised in Rabbit using Human ADPRHL2 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CYC1 antibody, catalog no. 70R-2516</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PSMA4 antibody, catalog no. 70R-4317</p>

<p>Beta Amyloid aa 1-16 Monoclonal Antibody</p>

<p>Rabbit polyclonal PSEN1 antibody (Ser357)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TNFSF4 antibody, catalog no. 70R-9667</p>

<p>Rabbit polyclonal TPM1 antibody (HRP)</p>

<p>Purified recombinant Human HSPB9 Protein (His tag)</p>

<p>GFAP antibody is a highly specific monoclonal antibody used in Life Sciences research. It targets glial fibrillary acidic protein (GFAP), which is an intermediate filament protein found in astrocytes, a type of glial cell in the central nervous system. This antibody recognizes and binds to GFAP, allowing researchers to study the expression and localization of this protein.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Fmo3 antibody, catalog no. 70R-8601</p>

<p>Purified Polyclonal PANK2 antibody</p>

<p>Purified Rabbit polyclonal WRKY3.1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Man2a2 antibody, catalog no. 70R-8659</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FMO3 antibody, catalog no. 70R-6582</p>

<p>The IPKA antibody is a histidine-rich growth factor that is capable of neutralizing autoantibodies. It belongs to the class of monoclonal antibodies and has shown promising results in various studies. The IPKA antibody has been extensively studied in the field of Life Sciences and has been found to have natriuretic and neuroprotective properties. It works by specifically targeting and binding to specific antigens, leading to an antigen-antibody reaction that helps in the activation of certain biological processes. With its unique properties, the IPKA antibody holds great potential for therapeutic applications in various fields.</p>

<p>DPYS antibody was raised in Rabbit using Human DPYS as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF624 antibody, catalog no. 70R-7960</p>

<p>AGPAT3 antibody was raised in rabbit using the middle region of AGPAT3 as the immunogen</p>

<p>Rabbit polyclonal Thioredoxin antibody (FITC)</p>

<p>The KLRG1 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and inhibit the proteolytic activity of KLRG1, a protein involved in cell cytotoxicity. This antibody specifically binds to KLRG1, preventing its interaction with other proteins and inhibiting its function.</p>

<p>The IL1b antibody is a specific antibody that is commonly used in the field of Life Sciences. This antibody is designed to specifically bind to IL1b, which is a protein involved in immune response and inflammation. The IL1b antibody can be used for various applications, including immobilization on an electrode for detection purposes. It recognizes tyrosine residues on IL1b and can be used to study the activation of this protein. Additionally, the IL1b antibody can be used in research related to cancer treatment, as it has been shown to have antagonist binding properties against oncogenic kinases such as epidermal growth factor receptor (EGFR). Overall, the IL1b antibody is a valuable tool for researchers studying immune response, inflammation, and cancer biology.</p>

<p>GADD45A antibody was raised in Rabbit using Human GADD45A as the immunogen</p>

<p>The Beta-2-microglobulin monoclonal antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody specifically targets and binds to Beta-2-microglobulin, a protein found on the surface of cells. By binding to this protein, the antibody can modulate various cellular processes.</p>

<p>Purified Rabbit polyclonal MYB11 antibody</p>

<p>The Rab1A antibody is a highly effective growth factor that is used in the field of Life Sciences. This biochemical compound is available in both monoclonal and polyclonal forms, making it versatile for various applications. The Rab1A antibody works by inhibiting the activity of Rab1A, a protein involved in intracellular trafficking. By blocking this protein, the antibody prevents the transport of molecules within cells, thereby affecting cellular processes such as nuclear signaling and e-cadherin expression. With its high specificity and affinity, this antibody is an essential tool for researchers studying cellular mechanisms and developing new medicaments. Whether you're working on a colloidal microsphere or exploring inhibitors for specific pathways, the Rab1A antibody is an indispensable asset in your scientific arsenal. Trust its exceptional performance to deliver accurate results and advance your research in the field of Life Sciences.</p>

<p>Region of IL1R alpha protein corresponding to amino acids MRPSGRKSSK MQAFRIWDVN QKTFYLRNNQ LVAGYLQGPN VNLEEKIDVV PIEPHALFLG IHGGKMCLSC VKSGDETRLQ LEAVNITDLS ENRKQDKRFA FIRSDSGPTT SFESAACPGW FLCTAMEADQ PVSLTNMPDE GVMVTKFYFQ EDE.</p>

<p>DDA1 antibody was raised in Rabbit using Human DDA1 as the immunogen</p>

<p>Rabbit polyclonal Claudin 3 antibody (Tyr219)</p>

<p>Sheep anti Bovine IgM secondary antibody (HRP)</p>

<p>Affinity purified Rabbit polyclonal MPP2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LOC642486 antibody, catalog no. 70R-1977</p>

<p>CACNG4 antibody was raised using the N terminal of CACNG4 corresponding to a region with amino acids GPPPRRARGDLTHSGLWRVCCIEGIYKGHCFRINHFPEDNDYDHDSSEYL</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LDHA antibody, catalog no. 70R-3736</p>

<p>1110067D22Rik antibody was raised in rabbit using the middle region of 1110067D22Rik as the immunogen</p>

<p>The MMP2 antibody is a highly specialized polyclonal antibody that targets the matrix metalloproteinase 2 (MMP2) protein. This antibody is widely used in life sciences research to study the role of MMP2 in various biological processes. MMP2 is a key enzyme involved in the degradation of extracellular matrix components, and its dysregulation has been implicated in several diseases, including cancer, cardiovascular diseases, and inflammatory disorders.</p>

<p>Purified Polyclonal MRPL15 antibody</p>

<p>Rabbit polyclonal BID antibody (Ser78)</p>

<p>Purified Polyclonal AGBL4 antibody</p>

<p>Rabbit polyclonal MAPKAPK5 antibody</p>

<p>Purified recombinant Human CARHSP1 protein</p>

<p>Rabbit polyclonal Rhombotin 1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Phkg1 antibody, catalog no. 70R-9422</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FLJ33706 antibody, catalog no. 70R-8168</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of EPB42 antibody, catalog no. 70R-3611</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PIP3-E antibody, catalog no. 70R-1020</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PSME2 antibody, catalog no. 70R-9401</p>

<p>The CEA antibody is a monoclonal antibody that targets the carcinoembryonic antigen (CEA), a protein that is overexpressed in certain types of cancer cells. This antibody specifically binds to CEA and can be used for various applications in the field of Life Sciences. It has been widely used in research studies to detect CEA expression in tumor tissues and monitor its levels in patient samples.</p>

<p>HIV1 gp120 antibody (biotin) was raised in rabbit using purified, full length recombinant gp120 (HIV-1) produced in baculovirus expression system as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C2orf3 antibody, catalog no. 70R-9582</p>

<p>SMG5 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSQGPPTGESSEPEAKVLHTKRLYRAVVEAVHRLDLILCNKTAYQEVFKP</p>

<p>Affinity purified Rabbit polyclonal MAP3K2 antibody</p>

<p>DCUN1D3 antibody was raised using a synthetic peptide corresponding to a region with amino acids LNFLTENPSGIKGISRDTWNMFLNFTQVIGPDLSNYSEDEAWPSLFDTFV</p>

<p>MEGF11 antibody was raised in rabbit using the middle region of MEGF11 as the immunogen</p>

<p>CUGBP2 antibody was raised using the N terminal of CUGBP2 corresponding to a region with amino acids VYQINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNIKTLPGMHHP</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TSHR antibody, catalog no. 70R-2915</p>

<p>Cytokeratin 13 Monoclonal Antibody</p>

<p>COPG2 antibody was raised using the N terminal of COPG2 corresponding to a region with amino acids MIKKFDKKDEESGSGSNPFQHLEKSAVLQEARIFNETPINPRRCLHILTK</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ST8SIA6 antibody, catalog no. 70R-6324</p>

<p>Rabbit polyclonal GRIN2A antibody (N-terminus)</p>

<p>The SIGLEC9 antibody is a polyclonal antibody that specifically targets SIGLEC9, a glycoprotein that plays a crucial role in various biological processes. This antibody is produced using glycine and disulfide bond technology, resulting in high-quality antibodies with excellent specificity and sensitivity. It can be used in various applications in the field of life sciences, such as immunohistochemistry, flow cytometry, and Western blotting.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RAD54B antibody, catalog no. 70R-5653</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Psmd10 antibody, catalog no. 70R-9400</p>

<p>The TYK2 antibody is a highly specific monoclonal antibody that targets the TYK2 protein kinase. It is commonly used in research laboratories to study various cellular processes and signaling pathways. This antibody has been extensively validated for its specificity and sensitivity in detecting TYK2 in various biological samples, including nuclear extracts, growth factor-treated cells, and tissue lysates.</p>

<p>Purified Cat IgG FITC conjugate</p>

<p>CHST1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SFVGQLFNQHLDVFYLFEPLYHVQNTLIPRFTQGKSPADRRVMLGASRDL</p>

<p>NR0B1 antibody was raised using the middle region of NR0B1 corresponding to a region with amino acids FCGEDHPQQGSTLYCVPTSTNQAQAAPEERPRAPWWDTSSGALRPVALKS</p>

<p>The CCL2 antibody is a powerful tool in the field of immunology. It specifically targets and binds to the chemokine CCL2, also known as monocyte chemoattractant protein-1 (MCP-1). This antibody has been extensively studied and proven to have a wide range of applications.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HNRPH3 antibody, catalog no. 70R-1326</p>

<p>RNA polymerase II CTD repeat YSPTSPS (phospho S5) Monoclonal Antibody</p>

<p>SEPN1 antibody was raised in rabbit using the C terminal of SEPN1 as the immunogen</p>

<p>MYL4 antibody was raised in rabbit using the N terminal of MYL4 as the immunogen</p>

<p>CREB3L4 antibody was raised in Rabbit using Human CREB3L4 as the immunogen</p>

<p>Purified Bovine IgG HRP conjugate</p>

<p>AP1B1 antibody was raised in Rabbit using Human AP1B1 as the immunogen</p>

<p>Purified recombinant Human URM1 protein</p>

<p>Rabbit polyclonal KANK2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DDX47 antibody, catalog no. 70R-1381</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CLEC4M antibody, catalog no. 70R-1704</p>

<p>FADS3 antibody was raised in Rabbit using Human FADS3 as the immunogen</p>

<p>Rabbit polyclonal ACTHR antibody</p>

<p>ALG13 antibody was raised in Rabbit using Human ALG13 as the immunogen</p>

<p>DBH antibody was raised in Rabbit using Human DBH as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of IQCD antibody, catalog no. 70R-4434</p>

<p>Rabbit polyclonal Histone H2Ax antibody (HRP)</p>

<p>Rabbit polyclonal AMPH antibody</p>

<p>The Elk1 antibody is a polyclonal antibody used in Life Sciences research. It specifically targets the cholinergic pathway and has neutralizing properties. This monoclonal antibody is a highly reactive medicament that can inhibit the activity of Elk1, a transcription factor involved in various cellular processes. The Elk1 antibody can be used in experiments to study the inhibitory properties of Elk1 and its role in signaling pathways. Additionally, this antibody has been shown to interact with other globulin proteins and may have natriuretic and neurotrophic factors activation effects. Researchers in the field of Life Sciences can rely on the Elk1 antibody for accurate and reliable results in their studies.</p>

<p>The MARCKS antibody is a genotoxic glycopeptide that is used in Life Sciences research. It is a monoclonal antibody that specifically targets the MARCKS protein. This protein plays a crucial role in cellular processes such as cell adhesion, migration, and signaling. The MARCKS antibody can be used to study the function and regulation of this protein in various biological systems.</p>

<p>Affinity purified Rabbit polyclonal Calpain 1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GARS antibody, catalog no. 70R-2361</p>

<p>Protein C antibody (HRP) was raised in sheep using human Protein C purified from plasma as the immunogen.</p>

<p>Purified Horse IgG (Fc) HRP conjugate</p>

<p>The Myc antibody is a highly specialized product in the field of Life Sciences. It belongs to the category of Antibodies and is used for various applications. This antibody specifically targets vasoactive intestinal peptide (VIP), interferon, acidic, macrophage colony-stimulating factor (M-CSF), activated glutamate, colony-stimulating factor (CSF), alpha-fetoprotein, human serum, IFN-gamma, phosphatase, and other related factors.</p>

<p>Nucleophosmin antibody was raised in Mouse using a purified recombinant fragment of human NPM expressed in E. coli as the immunogen.</p>

<p>BLK antibody was raised using the middle region of BLK corresponding to a region with amino acids AVVTKEPIYIVTEYMARGCLLDFLKTDEGSRLSLPRLIDMSAQIAEGMAY</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DUSP8 antibody, catalog no. 70R-5713</p>

<p>The RRP1 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to specifically target and bind to dopamine, a neurotransmitter found in the human serum. This antibody can be used for various applications, including the detection and quantification of dopamine levels in biological samples.</p>

<p>Affinity purified Rabbit polyclonal ALOX5 antibody</p>

<p>ATP6AP1 antibody was raised in Rabbit using Human ATP6AP1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of XAB2 antibody, catalog no. 70R-8953</p>

<p>ALDH4A1 antibody was raised using the N terminal of ALDH4A1 corresponding to a region with amino acids QGKTVIQAEIDAAAELIDFFRFNAKYAVELEGQQPISVPPSTNSTVYRGL</p>

<p>APPL1 antibody was raised in Rabbit using Human APPL1 as the immunogen</p>

<p>Rabbit polyclonal PRMT2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of EPHX1 antibody, catalog no. 70R-5354</p>

<p>The RPS16 antibody is a highly specialized protein that plays a crucial role in various cellular processes. It interacts with caveolin-1, a key protein involved in cell signaling and membrane trafficking. The RPS16 antibody has been extensively studied in the field of Life Sciences and has been shown to regulate the activity of reductase enzymes, which are important for cellular metabolism.</p>

<p>The AQP3 antibody is a spectrometric monoclonal antibody that is used in Life Sciences research. It specifically targets the aquaporin-3 (AQP3) protein, which plays a crucial role in water and glycerol transport across cell membranes. This antibody has been extensively studied and validated for its ability to detect AQP3 in various samples, including human serum.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PRMT3 antibody, catalog no. 70R-3706</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Slc9a5 antibody, catalog no. 70R-8579</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SIPA1 antibody, catalog no. 70R-6080</p>

<p>CHRNA5 antibody was raised in Rabbit using Human CHRNA5 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of METTL5 antibody, catalog no. 70R-3352</p>

<p>Purified Polyclonal GPR105 antibody</p>

<p>VNN2 antibody was raised in rabbit using the C terminal of VNN2 as the immunogen</p>

<p>SDS antibody was raised using the middle region of SDS corresponding to a region with amino acids KITSVAKALGVKTVGAQALKLFQEHPIFSEVISDQEAVAAIEKFVDDEKI</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TRIM23 antibody, catalog no. 20R-1190</p>

<p>Fibrinogen antibody (HRP) was raised in sheep using Rabbit Fibrinogen purified from plasma as the immunogen.</p>

<p>Mycoplasma pneumoniae antibody is a monoclonal antibody that specifically targets the antigen-antibody reaction associated with Mycoplasma pneumoniae infection. This antibody is highly reactive and can effectively neutralize the autoantibodies produced during an infection, reducing cytotoxic effects on host cells. The bioavailability of this antibody is enhanced by its conjugation to cellulose, which allows for targeted delivery to infected cells. In addition to its neutralizing properties, this antibody also activates cell cytotoxicity mechanisms, further enhancing its effectiveness in combating Mycoplasma pneumoniae. Monoclonal Antibodies against annexin A2 have also been developed as therapeutic agents for Mycoplasma pneumoniae infections.</p>

<p>GFM2 antibody was raised in rabbit using the C terminal of GFM2 as the immunogen</p>

<p>Recombinant human IL-6</p>

<p>Fresh tissue lysate isolated from human stomach</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MFAP3L antibody, catalog no. 70R-1726</p>

<p>TGDS antibody was raised using the middle region of TGDS corresponding to a region with amino acids DEVYGGSLDKEFDESSPKQPTNPYASSKAAAECFVQSYWEQYKFPVVITR</p>

<p>PPIA antibody was raised using a synthetic peptide corresponding to a region with amino acids TAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE</p>

<p>The Lamin B2 antibody is a highly specialized antibody that targets autoantibodies in cardiomyocytes. It is also effective against anti-mesothelin antibodies. This antibody plays a crucial role in the field of Life Sciences and medicine, as it serves as a serum marker for various diseases and conditions. The Lamin B2 antibody has been shown to interact with dopamine, which is involved in numerous physiological processes. Additionally, this antibody has the ability to activate methyltransferase enzymes and modulate interleukin levels. Furthermore, it influences the release of acetylcholine and regulates transmembrane conductance. With its unique properties and high specificity, the Lamin B2 antibody is an essential tool for researchers and healthcare professionals alike.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Hspb7 antibody, catalog no. 70R-8510</p>

<p>Rabbit Polyclonal NFkB p105 antibody (Ser932)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PPM1M antibody, catalog no. 70R-3594</p>

<p>CAMK1G antibody was raised using the middle region of CAMK1G corresponding to a region with amino acids KDFICHLLEKDPNERYTCEKALSHPWIDGNTALHRDIYPSVSLQIQKNFA</p>

<p>Purified recombinant STX4 protein (His tag)</p>

<p>Rabbit Polyclonal cJun antibody</p>

<p>The HER2 antibody, also known as trastuzumab, is a highly effective cytotoxic agent used in the treatment of various cancers. This monoclonal antibody specifically targets the HER2 receptor, a glycoprotein that plays a crucial role in cell growth and division. By binding to the HER2 receptor, trastuzumab inhibits its activity and prevents the growth and proliferation of cancer cells.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C19orf28 antibody, catalog no. 70R-6785</p>

<p>Purified recombinant Human NCK1 protein</p>

<p>ENPP6 antibody was raised in Rabbit using Human ENPP6 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RBM4 antibody, catalog no. 70R-4829</p>

<p>The RAD50 antibody is a collagen-based monoclonal antibody used in bioassays within the Life Sciences field. It is designed for intraocular use and can be immobilized on microspheres or colloidal particles for ultrasensitive detection. This antibody demonstrates high reactivity with human serum, making it an ideal tool for various diagnostic applications. Additionally, the RAD50 antibody can be used in electrode-based assays to detect the presence of growth factors and other biomarkers. Its specificity and reliability have been validated through extensive testing using hybridoma cells that produce this monoclonal antibody.</p>

<p>PCBP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KKGESVKKMREESGARINISEGNCPERIITLAGPTNAIFKAFAMIIDKLE</p>

<p>Rabbit polyclonal POLR2H antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TAF15 antibody, catalog no. 70R-4631</p>

<p>Lipoprotein Lipase Antibody is a potent monoclonal antibody that specifically targets and neutralizes the activity of lipoprotein lipase (LPL). LPL is an enzyme that plays a crucial role in lipid metabolism, particularly in adipose tissue. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PLA2G5 antibody, catalog no. 70R-5272</p>

<p>Purified Rabbit polyclonal EARS2 antibody</p>

<p>Rabbit polyclonal NR1I3 antibody</p>

<p>Purified recombinant Human COTL1 protein</p>

<p>Purified recombinant Human AMELX protein (His tag)</p>

<p>Purified Polyclonal Topoisomerase 2 beta antibody</p>

<p>The Merlin antibody is a highly specialized monoclonal antibody that targets specific proteins involved in various physiological processes. It has been shown to have a significant impact on the regulation of erythropoietin and endothelial growth factor, both of which play crucial roles in cell growth and development. Additionally, the Merlin antibody has been found to interact with androgen receptors, modulating their activity and influencing hormone response.</p>

<p>DDHD2 antibody was raised using the N terminal of DDHD2 corresponding to a region with amino acids DGWGSTPTEQGRPRTVKRGVENISVDIHCGEPLQIDHLVFVVHGIGPACD</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HYOU1 antibody, catalog no. 70R-6400</p>

<p>Goat anti-Human IgA (alpha chain) (HRP) was raised in goat using purified Human IgA as the immunogen.</p>

<p>FLJ44894 antibody was raised in rabbit using the middle region of FLJ44894 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FBXO24 antibody, catalog no. 70R-2810</p>

<p>F4/80 Antibody (HRP)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LTK antibody, catalog no. 70R-10027</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C17orf80 antibody, catalog no. 70R-6883</p>