Bioquímicos e reagentes

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C8orf45 antibody, catalog no. 70R-9222</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PPP3R1 antibody, catalog no. 70R-4295</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC26A5 antibody, catalog no. 70R-1782</p>

A synthetic peptide for use as a blocking control in assays to test for specificity of ATIC antibody, catalog no. 70R-1236

<p>Purified Polyclonal DNA Polymerase delta 1 antibody</p>

<p>Rabbit polyclonal PARK2 antibody (Ser101)</p>

<p>Purified Rabbit polyclonal BAIAP2L1 antibody</p>

<p>Rabbit polyclonal POLR2F antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C19orf25 antibody, catalog no. 70R-8036</p>

<p>Rabbit polyclonal DNA Polymerase alpha antibody</p>

<p>Goat anti-human IgG (HRP) was raised in goat using human IgG F(c) fragment as the immunogen.</p>

<p>ZFYVE1 antibody was raised in rabbit using the N terminal of ZFYVE1 as the immunogen</p>

<p>BCL2L1 antibody was raised in rabbit using the N terminal of BCL2L1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GINS2 antibody, catalog no. 70R-5624</p>

<p>Rabbit polyclonal AN32C antibody</p>

<p>IGF1R antibody was raised in rabbit using the middle region of IGF1R as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NOV antibody, catalog no. 70R-1714</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TM9SF1 antibody, catalog no. 70R-9642</p>

<p>H2AFY2 antibody was raised in Rabbit using Human H2AFY2 as the immunogen</p>

<p>Purified Rabbit polyclonal SLP11 antibody</p>

<p>Matrin 3 antibody was raised using the C terminal of MATR3 corresponding to a region with amino acids ADDPNKDTSENADGQSDENKDDYTIPDEYRIGPYQPNVPVGIDYVIPKTG</p>

<p>CHCHD3 antibody was raised using the N terminal of CHCHD3 corresponding to a region with amino acids RMKESSPSGSKSQRYSGAYGASVSDEELKRRVAEELALEQAKKESEDQKR</p>

<p>Klebsiella Aerogenes Monoclonal Antibody</p>

<p>33-190 amino acids: MGSSHHHHHH SSGLVPRGSH MEEVSEYCSH MIGSGHLQSL QRLIDSQMET SCQITFEFVD QEQLKDPVCY LKKAFLLVQD IMEDTMRFRD NTPNAIAIVQ LQELSLRLKS CFTKDYEEHD KACVRTFYET PLQLLEKVKN VFNETKNLLD KDWNIFSKNC NNSFAECSSQ DVVTKPDCN</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TRIM55 antibody, catalog no. 70R-2822</p>

<p>Rabbit polyclonal p44/42 MAP Kinase antibody</p>

<p>Purified Polyclonal Caspase 2 p18 antibody</p>

<p>The CD66b antibody is a monoclonal antibody that has a stimulatory effect on epidermal growth factor (EGF) signaling. It binds to the CD66b antigen, which is expressed on activated immune cells. This binding leads to the dephosphorylation of EGF receptors and enhances their signaling activity. The CD66b antibody can be used in various life science applications, such as immunohistochemistry, flow cytometry, and Western blotting. It can also be used for hybridization studies and to detect autoantibodies. Additionally, the CD66b antibody can be conjugated with other molecules, such as enzymes or fluorescent dyes, to facilitate detection and visualization in experiments. Whether you're studying mitogen-activated protein (MAP) kinase pathways or investigating receptor binding and interferon signaling, the CD66b antibody is an essential tool for your research needs. Choose from a range of formats, including chimeric proteins and polyclonal antibodies, to</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PRF1 antibody, catalog no. 70R-5927</p>

<p>Sec14l3 antibody was raised in rabbit using the C terminal of Sec14l3 as the immunogen</p>

<p>Rabbit polyclonal NFKB-p65 antibody</p>

<p>Purified Rabbit polyclonal YB1 antibody (Ser102)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TIRAP antibody, catalog no. 70R-5827</p>

<p>The ERK1/2 antibody is a monoclonal antibody that targets the extracellular signal-regulated kinase 1 and 2 (ERK1/2). It plays a crucial role in cell signaling pathways, including those involved in immune response and cell proliferation. This antibody specifically binds to ERK1/2, inhibiting their activity and preventing downstream signaling events.</p>

<p>SIAH1 antibody was raised in rabbit using the N terminal of SIAH1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of hCG_1646157 antibody, catalog no. 70R-9034</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PA2G4 antibody, catalog no. 20R-1262</p>

<p>The SDS antibody is a monoclonal antibody that specifically targets Tumor Necrosis Factor-alpha (TNF-α), a growth factor involved in various inflammatory processes. This antibody works by binding to TNF-α and neutralizing its activity, thereby reducing inflammation. Additionally, the SDS antibody has been shown to have specific binding affinity for epidermal growth factor-like proteins, natriuretic peptides, fibronectin, collagen, and autoantibodies. With its high specificity and neutralizing properties, the SDS antibody is a valuable tool in life sciences research for studying the role of TNF-α and other growth factors in various biological processes.</p>

<p>Rabbit polyclonal PSMB2 antibody (HRP)</p>

<p>MYL12B antibody was raised in Rabbit using Human MYL12B as the immunogen</p>

<p>Purified recombinant Bovine IFN-Tau protein (Bovine)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RAB2B antibody, catalog no. 70R-10149</p>

<p>1-246 amino acids: MGSSHHHHHH SSGLVPRGSH MGDREQLLQR ARLAEQAERY DDMASAMKAV TELNEPLSNE DRNLLSVAYK NVVGARRSSW RVISSIEQKT MADGNEKKLE KVKAYREKIE KELETVCNDV LSLLDKFLIK NCNDFQYESK VFYLKMKGDY YRYLAEVASG EKKNSVVEAS EAAYKEAFEI SKEQMQPTHP IRLGLALNFS VFYYEIQNAP EQACLLAKQA FDDAIAELDT LNEDSYKDST LIMQLLRDNL TLWTSDQQDE EAGEGN</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RNF170 antibody, catalog no. 70R-6665</p>

<p>The CEA antibody is a glycoprotein that is commonly found in human serum. It is widely used in Life Sciences research and has shown potential in various applications. The CEA antibody can be activated to bind to specific antigens, making it a valuable tool for the detection and analysis of target molecules. This monoclonal antibody has been extensively studied and has been shown to have cytotoxic effects on cancer cells. Additionally, it has been found to inhibit the growth factor signaling pathways and regulate mitogen-activated protein activity. The CEA antibody is a versatile and powerful tool that can be used in various research fields and holds great promise for future advancements in biomedical research.</p>

<p>The PSPH antibody is a monoclonal antibody produced by a hybridoma cell strain. It is designed to specifically target and bind to the PSPH protein, which plays a crucial role in various biological processes. The antibody can be used in life sciences research, diagnostic assays, and therapeutic applications.</p>

<p>Region of WISP3 protein corresponding to amino acids TGPLDTTPEG RPGEVSDAPQ RKQFCHWPCK CPQQKPRCPP GVSLVRDGCG CCKICAKQPG EICNEADLCD PHKGLYCDYS VDRPRYETGV CAYLVAVGCE FNQVHYHNGQ VFQPNPLFSC LCVSGAIGCT PLFIPKLAGS HCSGAKGGKK SDQSNCSLEP LLQQLSTSYK TMPAYRNLPL IWKKKCLVQA TKWTPCSRTC GMGISNRVTN ENSNCEMRKE KRLCYIQPCD SNILKTIKIP KGKTCQPTFQ LSKAEKFVFS GCSSTQSYKP TFCGICLDKR CCIPNKSKMI TIQFDCPNEG SFKWKMLWIT SCVCQRNCRE PGDIFSELKI L.</p>

<p>PPP1R8 antibody was raised using a synthetic peptide corresponding to a region with amino acids VDPSVGRFRNMVQTAVVPVKKKRVEGPGSLGLEESGSRRMQNFAFSGGLY</p>

<p>CLIC4 antibody was raised using the N terminal of CLIC4 corresponding to a region with amino acids LSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVF</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC22A12 antibody, catalog no. 70R-7371</p>

<p>The PAK1 antibody is a cytotoxic agent that targets the PAK1 isoenzyme. It belongs to the group of Polyclonal Antibodies, which are widely used in Life Sciences research. This antibody specifically binds to PAK1 and inhibits its activity, making it an essential tool for studying the role of PAK1 in various cellular processes. The PAK1 antibody can be used in experiments involving collagen, epidermal growth factor, hepatocyte growth factor, and other related molecules. It is available as a monoclonal antibody, ensuring high specificity and reproducibility in experiments. Additionally, this antibody has been shown to be activated in the presence of certain autoantibodies and levothyroxine, making it a versatile tool for multiple applications.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HDAC11 antibody, catalog no. 70R-5538</p>

<p>This antibody reacts with heavy (gamma) chains on rat IgG and light chains on all rat immunoglobulins.</p>

<p>The GPC5 antibody is a highly specialized Polyclonal Antibody that targets the lipoprotein lipase, an enzyme involved in lipid metabolism. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications. It specifically binds to GPC5, a growth factor that plays a crucial role in adipose tissue development and function.</p>

<p>Goat anti-mouse IgM (biotin) was raised in goat using murine IgM heavy chain as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SERTAD2 antibody, catalog no. 70R-9093</p>

<p>Affinity purified Rabbit polyclonal TNFAP1 antibody</p>

<p>The Fenitrothion antibody is a powerful tool used in research and diagnostics. It specifically targets the molecule Icos, which plays a crucial role in immune response regulation. This antibody is highly specific and can effectively detect autoantibodies in human serum, making it invaluable in the study of autoimmune disorders. Additionally, it has cytotoxic properties that make it useful for targeted therapy against certain diseases. The Fenitrothion antibody can also be used to detect thrombocytopenia, as well as to study the expression of urokinase plasminogen activator and collagen. Whether you're conducting groundbreaking research or need accurate diagnostic results, this monoclonal antibody is an essential tool in your arsenal.</p>

<p>Rabbit polyclonal AKAP14 antibody</p>

<p>HSPA6 antibody was raised using a synthetic peptide corresponding to a region with amino acids EYEHQKRELEQICRPIFSRLYGGPGVPGGSSCGTQARQGDPSTGPIIEEV</p>

<p>Cardiotrophin 1 antibody was raised in rabbit using highly purerecombinant hCT-1 (human Cardiotrophin-1) as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GFPT2 antibody, catalog no. 70R-8530</p>

<p>E2F8 antibody was raised in Rabbit using Human E2F8 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GAS8 antibody, catalog no. 70R-3968</p>

<p>Rabbit polyclonal NUF2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MAP3K14 antibody, catalog no. 70R-3485</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RAP1GDS1 antibody, catalog no. 70R-9838</p>

<p>Rabbit anti-human IgG (Rhodamine) was raised in rabbit using human IgG F(ab')2 fragment as the immunogen.</p>

<p>Hantavirus antibody was raised in mouse using recombinant puumala nucleocaspid protein as the immunogen.</p>

<p>The CXCR2 antibody is a highly effective tool used in the field of life sciences. It is a glycoprotein that specifically targets and binds to the CXCR2 receptor, which plays a crucial role in various cellular processes such as endothelial growth and chemokine signaling. This antibody is widely used in research settings to study the function of CXCR2 and its involvement in different biological pathways.</p>

<p>Affinity purified Rabbit polyclonal FBXL12 antibody</p>

<p>The RhoH antibody is a polyclonal antibody that is specifically designed to target and bind to RhoH, a protein involved in various cellular processes. This antibody has been extensively tested and validated for its specificity and sensitivity in detecting RhoH in different samples.</p>

<p>The ApoD antibody is a monoclonal antibody that specifically targets tumor necrosis factor-alpha (TNF-α). It is produced by hybridoma cells and has been widely used in the field of Life Sciences for research purposes. This monoclonal antibody has shown to effectively neutralize TNF-α, which plays a crucial role in inflammation and immune response. In addition to TNF-α, the ApoD antibody also targets other cytokines such as interleukin-6 (IL-6) and leukemia inhibitory factor (LIF). The binding of this antibody to its target molecules can modulate various cellular processes including transmembrane conductance, epidermal growth factor signaling, and oncogenic kinase activity. With its high specificity and affinity, the ApoD antibody is a valuable tool for researchers studying these pathways and exploring potential therapeutic applications. Additionally, polyclonal antibodies against ApoD are also available for researchers who require a broader range of epitope recognition.</p>

<p>C1orf96 antibody was raised using the middle region of C1orf96 corresponding to a region with amino acids ENKHPFALYGWGEKQTDTGSQKTHNVCASAPVHEIHESALRAKNRRQVEK</p>

<p>Rabbit polyclonal EXTL3 antibody (HRP)</p>

<p>Rabbit polyclonal MPZ antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KCTD11 antibody, catalog no. 70R-1491</p>

<p>Purified recombinant Human MYL12B Protein (His tag)</p>

<p>TCEAL8 antibody was raised in rabbit using the middle region of TCEAL8 as the immunogen</p>

<p>Rabbit polyclonal NFKB p105 antibody</p>

<p>This antibody reacts with heavy chains on human IgG (gamma chain).</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KCNH6 antibody, catalog no. 70R-5116</p>

<p>Atp5d antibody was raised in rabbit using the C terminal of Atp5d as the immunogen</p>

<p>ARL15 antibody was raised in Rabbit using Human ARL15 as the immunogen</p>

<p>PSMA5 antibody was raised using a synthetic peptide corresponding to a region with amino acids FGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLK</p>

<p>ACAD8 antibody was raised in Rabbit using Human ACAD8 as the immunogen</p>

<p>Rabbit polyclonal Glucokinase Regulator antibody</p>

<p>Recombinant Human NT5C3B protein</p>

<p>RAD51L3 antibody was raised in rabbit using the C terminal of RAD51L3 as the immunogen</p>

<p>CD48 antibody was raised in Rabbit using Human CD48 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ATPAF1 antibody, catalog no. 70R-9517</p>

<p>Purified Polyclonal CABP5 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KCND2 antibody, catalog no. 70R-5109</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF259 antibody, catalog no. 70R-8255</p>

<p>DNM1 antibody was raised in Rabbit using Human DNM1 as the immunogen</p>

<p>Resistin antibody (biotin) was raised in goat using highly pure recombinant murine resistin as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ASF1A antibody, catalog no. 70R-9597</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ACAT2 antibody, catalog no. 70R-1083</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LOC339977 antibody, catalog no. 70R-6659</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FN1 antibody, catalog no. 70R-6082</p>

<p>Synaptojanin 1 antibody was raised using the middle region of SYNJ1 corresponding to a region with amino acids PGVARREMEAPKSPGTTRKDNIGRSQPSPQAGLAGPGPAGYSTARPTIPP</p>

<p>RBMS3 antibody was raised using the middle region of RBMS3 corresponding to a region with amino acids PTAVSIEGVVADTSPQTVAPSSQDTSGQQQQIAVDTSNEHAPAYSYQQSK</p>

<p>NDUFA9 antibody was raised in Rabbit using Human NDUFA9 as the immunogen</p>

<p>GSTM5 antibody was raised in Rabbit using Human GSTM5 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LMF2 antibody, catalog no. 70R-6271</p>

<p>Affinity purified Rabbit polyclonal C1orf165 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ADH1B antibody, catalog no. 70R-3920</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ALKBH8 antibody, catalog no. 70R-5009</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NT5C1B antibody, catalog no. 70R-4405</p>

<p>EEFSEC antibody was raised in Rabbit using Human EEFSEC as the immunogen</p>

<p>The STAT3 antibody is a powerful tool used in Life Sciences research. It is designed to specifically target and bind to the STAT3 protein, which plays a crucial role in cell signaling and gene expression. This antibody can be used for various applications, including Western blotting, immunohistochemistry, and immunofluorescence.</p>

<p>The SERPINB13 antibody is a highly effective anti-HER2 monoclonal antibody. It belongs to the class of monoclonal antibodies and specifically targets HER2, a protein that is overexpressed in certain types of cancer cells. By binding to HER2, this antibody inhibits its activity and prevents the growth and spread of cancer cells.</p>

<p>Rabbit polyclonal NUDT6 antibody</p>

<p>KCNIP3 antibody was raised in Rabbit using Human KCNIP3 as the immunogen</p>

<p>Rabbit polyclonal PIGO antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SNTB1 antibody, catalog no. 70R-6691</p>

<p>Influenza A antibody (H3N2) (biotin) was raised in goat using influenza A, strain Texas 1/77 (H3N2) as the immunogen.</p>

<p>DRD2 antibody was raised in Rabbit using Human DRD2 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GRIP1 antibody, catalog no. 70R-7931</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PARN antibody, catalog no. 20R-1155</p>

<p>This antibody reacts with heavy (gamma) chains on rat IgG and light chains on all rat immunoglobulins.</p>

<p>The ALDH2 antibody is a monoclonal antibody used in Life Sciences research. It has been shown to effectively neutralize ALDH2 activity, which is essential for the metabolism of ethanol and other aldehydes. This antibody can be used in various applications such as lysis and electrode-based assays to study the role of ALDH2 in different biological processes.</p>

<p>DDT antibody was raised in Rabbit using Human DDT as the immunogen</p>

<p>Purified recombinant E.coli NDK protein (His tag)</p>

<p>IKBKG antibody was raised in Rabbit using Human IKBKG as the immunogen</p>

<p>ERCC1 antibody was raised in Rabbit using Human ERCC1 as the immunogen</p>

<p>Purified Polyclonal CEBP beta antibody</p>

<p>Rabbit polyclonal ANKRD20A3 antibody</p>

<p>IL8RB antibody was raised in Rabbit using Human IL8RB as the immunogen</p>

<p>Cytochrome b245 Light Chain Monoclonal Antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CANT1 antibody, catalog no. 70R-5814</p>

<p>The nNOS antibody is a powerful tool used in life sciences research. It is a monoclonal antibody that specifically targets neuronal nitric oxide synthase (nNOS), an enzyme involved in the production of nitric oxide. This antibody can be used for various applications, including immunohistochemistry, western blotting, and flow cytometry.</p>

<p>FBXO2 antibody was raised in Rabbit using Human FBXO2 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ELAVL4 antibody, catalog no. 70R-4836</p>

<p>Keratin K76 antibody was raised in Guinea Pig using synthetic peptide (C-LGGAGSISVSHSGM) of human keratin coupled to KLH as the immunogen.</p>

<p>COX4I2 antibody was raised in Rabbit using Human COX4I2 as the immunogen</p>

<p>Rabbit polyclonal TIMP2 antibody (FITC)</p>

<p>The ALDH1A2 antibody is a highly specialized product in the field of Life Sciences and Antibodies. It is specifically designed to target and interact with ALDH1A2, a growth factor that plays a crucial role in various biological processes. This antibody has been extensively tested and validated for its effectiveness in detecting and quantifying ALDH1A2 levels.</p>

<p>CDKL3 antibody was raised in Rabbit using Human CDKL3 as the immunogen</p>

<p>Rabbit polyclonal Catenin gamma antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CD22 antibody, catalog no. 70R-9913</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of BTNL9 antibody, catalog no. 70R-7019</p>

<p>Endogl1 antibody was raised in rabbit using the N terminal of Endogl1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ACSS2 antibody, catalog no. 70R-10248</p>

<p>Rabbit polyclonal ABHD14A antibody</p>

<p>Rabbit polyclonal OVOL1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ACMSD antibody, catalog no. 70R-6311</p>

<p>EXOC6 antibody was raised using the middle region of EXOC6 corresponding to a region with amino acids YRCLHIYSVLGDEETFENYYRKQRKKQARLVLQPQSNMHETVDGYRRYFT</p>

<p>Region of CNTF protein corresponding to amino acids MAFTEHSPLT PHRRDLCSRS IWLARKLRSD LTALTESYVK HQGLNKNINL DSADGMPVAS TDQWSELTEA ERLQENLQAY RTFHVLLARL LEDQQVHFTP TEGDFHQAIH TLLLQVAAFA YQIEELMILL EYKIPRNEAD GMPINVGDGG LFEKKLWGLK VLQELSQWTV RSIHDLRFIS SHQTGIPARG SHYIANNKKM.</p>

<p>Purified recombinant Human STX2 Protein (His tag)</p>

<p>Rabbit Polyclonal Androgen Receptor antibody (Ser650)</p>

<p>COCH antibody was raised in Rabbit using Human COCH as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SIGLEC12 antibody, catalog no. 70R-6150</p>

<p>Affinity purified Rabbit polyclonal HIF2 alpha antibody</p>

<p>FSCN1 antibody was raised in Rabbit using Human FSCN1 as the immunogen</p>

<p>LOXL4 antibody was raised in rabbit using the middle region of LOXL4 as the immunogen</p>

<p>GPR35 antibody was raised in Rabbit using Human GPR35 as the immunogen</p>

<p>The SPARC antibody is a highly specialized nuclear antibody that is widely used in the field of Life Sciences. It specifically targets collagen and serves as an electrode for various research applications. Additionally, this antibody has neutralizing properties and can effectively bind to alpha-fetoprotein, making it a valuable tool in cancer research. The SPARC antibody is a monoclonal antibody that also exhibits anti-mesothelin activity and can be used as an antiviral agent. It is commonly employed in the development of inhibitors and therapeutic antibodies. This product is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs. The SPARC antibody is activated upon interaction with human serum, allowing for precise detection and analysis of growth factors.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GRIP1 antibody, catalog no. 20R-1077</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HNF1A antibody, catalog no. 70R-9085</p>

<p>Affinity purified Rabbit polyclonal HSP70s antibody</p>

<p>PRTN3 antibody was raised in rabbit using the N terminal of PRTN3 as the immunogen</p>

<p>GFAP antibody was raised in rabbit using the C terminus of the 50 kDa human protein as the immunogen.</p>

<p>NGEF antibody was raised in Rabbit using Human NGEF as the immunogen</p>

<p>Rabbit polyclonal SmG antibody (biotin)</p>

<p>The AMH antibody is a highly potent and cytotoxic human protein that acts as a growth factor. It is capable of causing lysis and immobilization of target cells, making it an effective tool for research and diagnostic purposes. This antibody has been extensively studied for its neutralizing properties against insulin and insulin antibodies, making it a valuable asset in the field of diabetes research. Additionally, it has shown promising results in the detection and quantification of autoantibodies associated with various diseases. The AMH antibody also plays a crucial role in Life Sciences, particularly in the study of fibronectin, collagen, β-catenin, and other important cellular components. With both polyclonal and monoclonal variants available, this antibody offers versatility and reliability in scientific investigations.</p>

<p>18-247 amino acids: MGSSHHHHHH SSGLVPRGSH MEDDVTTTEE LAPALVPPPK GTCAGWMAGI PGHPGHNGTP GRDGRDGTPG EKGEKGDAGL LGPKGETGDV GMTGAEGPRG FPGTPGRKGE PGEAAYVYRS AFSVGLETRV TVPNVPIRFT KIFYNQQNHY DGSTGKFYCN IPGLYYFSYH ITVYMKDVKV SLFKKDKAVL FTYDQYQEKN VDQASGSVLL HLEVGDQVWL QVYGDGDHNG LYADNVNDST FTGFLLYHDT N</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ASGR2 antibody, catalog no. 70R-2075</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SRGAP1 antibody, catalog no. 70R-9502</p>

<p>CCDC146 antibody was raised using the middle region of CCDC146 corresponding to a region with amino acids KEIEKEWLKVLRDEEMHALAIAEKSQEFLEADNRQLPNGVYTTAEQRPNA</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Nxph1 antibody, catalog no. 70R-9330</p>

<p>Rabbit Polyclonal HSF1 antibody (Ser303)</p>

<p>AKR1C3 antibody was raised in Rabbit using Human AKR1C3 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HLTF antibody, catalog no. 70R-8247</p>

<p>The p53 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It plays a crucial role in the regulation of pluripotent cells and is activated in response to various cellular stresses. This inhibitory factor targets oncogenic kinases and promotes cell cycle arrest or apoptosis, depending on the severity of DNA damage. The p53 antibody is widely used for immunohistochemical detection and chromatin immunoprecipitation assays to study its binding activity and interactions with other proteins. Additionally, it has been found to have potential diagnostic value, as autoantibodies against p53 have been detected in certain cancers. Researchers rely on this powerful tool to investigate the intricate mechanisms involved in cellular responses and gain insights into cancer biology.</p>

<p>Rabbit polyclonal MRPL16 antibody</p>

<p>The Pleiotrophin antibody is a highly versatile and reactive chemokine that plays a crucial role in various biological processes. This antibody is available as both polyclonal and monoclonal forms, offering researchers flexibility in their experimental designs. It has been extensively studied in the field of Life Sciences due to its ability to neutralize the effects of Pleiotrophin, thereby modulating cellular functions.</p>

<p>Gliadin Antibody is a specific antibody that is used in various applications, particularly in the field of Life Sciences. It is commonly used for the detection and quantification of gliadin, a protein found in wheat and other gluten-containing grains. This antibody can be used in techniques such as hemolysis assays, reaction solutions, polymerase chain reactions (PCR), dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE), and more. The Gliadin Antibody is highly specific and recognizes gliadin with high affinity. It can be used to study the presence and distribution of gliadin in different samples, such as food products or biological samples. This antibody is often used in research related to celiac disease, gluten sensitivity, and other gluten-related disorders. Monoclonal antibodies are widely used in research and diagnostics due to their high specificity and reproducibility. The Gliadin Antibody is a monoclonal antibody, meaning it is</p>

<p>EPHA2 antibody was raised in Mouse using a purified recombinant fragment of EPHA2 expressed in E. coli as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PFKL antibody, catalog no. 70R-1248</p>

<p>The Desmin antibody is an important tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets Desmin, a protein involved in muscle cell structure and function. This antibody has been widely used in research to study the role of Desmin in various biological processes.</p>