Bioquímicos e reagentes

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CACNB2 antibody, catalog no. 70R-1501</p>

<p>HIBCH antibody was raised in Rabbit using Human HIBCH as the immunogen</p>

<p>RFPL2 antibody was raised using the C terminal of RFPL2 corresponding to a region with amino acids VSFFDAESGSHVYTFRSVSAEEPLRPFLAPSVPPNGDQGVLSICPLMNSG</p>

<p>Rabbit anti-mouse kappa chain (HRP) was raised in rabbit using murine kappa light chain as the immunogen.</p>

<p>Mouse monoclonal PTPN7 antibody</p>

<p>The SOX2 antibody is a highly specific and reliable tool used in immunohistochemistry and other life science research applications. This monoclonal antibody binds to the SOX2 antigen, which is a nuclear DNA-binding protein involved in the regulation of embryonic development and cell differentiation. The SOX2 antibody has been extensively validated for its performance in various experimental techniques, including electrochemical impedance spectroscopy.</p>

<p>Mouse monoclonal ACAT2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ERMAP antibody, catalog no. 70R-7347</p>

<p>The LGALS3BP antibody is a highly specialized monoclonal antibody that targets the fatty acid cyclase-activating protein (LGALS3BP). It is designed to specifically bind to LGALS3BP and neutralize its activity. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications.</p>

<p>Usp10 antibody was raised in rabbit using the C terminal of Usp10 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TRPC6 antibody, catalog no. 70R-5175</p>

<p>SREBF1 antibody was raised in rabbit using the middle region of SREBF1 as the immunogen</p>

<p>Nucleolar Protein NO38 antibody was raised in mouse using Nucleolar fraction prepared from Xenopus laevis oocytes as the immunogen.</p>

<p>Rabbit polyclonal ZNF596 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ASTN2 antibody, catalog no. 70R-6099</p>

<p>Calcitonin antibody is a growth factor that belongs to the class of monoclonal antibodies. It is a pegylated glycoprotein that specifically targets calcitonin, a hormone involved in regulating calcium levels in the body. This antibody binds to calcitonin and inhibits its activity, leading to decreased calcium levels. Calcitonin antibody has been extensively studied in the field of life sciences and has shown promising results in various research applications. Additionally, this antibody has been used in combination with other therapeutic agents such as trastuzumab to enhance their efficacy. With its cytotoxic properties and ability to neutralize calcitonin activity, this monoclonal antibody holds great potential for further advancements in the field of medicine.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GAS8 antibody, catalog no. 70R-4074</p>

<p>Goat anti-mouse IgG/IgM (H+L) (Alk Phos) was raised in goat using murine IgG and IgM whole molecules as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GTF3C5 antibody, catalog no. 70R-8086</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C2orf60 antibody, catalog no. 70R-9070</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of COL11A2 antibody, catalog no. 70R-6183</p>

<p>1-160 amino acids: MQPASAKWYD RRDYVFIEFC VEDSKDVNVN FEKSKLTFSC LGGSDNFKHL NEIDLFHCID PNDSKHKRTD RSILCCLRKG ESGQSWPRLT KERAKLNWLS VDFNNWKDWE DDSDEDMSNF DRFSEMMNNM GGDEDVDLPE VDGADDDSQD SDDEKMPDLE</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PPP1R12A antibody, catalog no. 70R-10251</p>

<p>6-Fluoro-3-indoxyl-beta-D-galactopyranoside:<br>Experience the power of 6-Fluoro-3-indoxyl-beta-D-galactopyranoside, the ultimate antituberculosis drug from the rifamycins class. This potent compound is specifically designed to combat tuberculosis infection by targeting active compounds and exhibiting bactericidal activity. Its unique mechanism of action involves binding to DNA-dependent RNA polymerase, effectively preventing transcription and replication. With its high frequency of human activity demonstrated through patch-clamp technique on human erythrocytes, it is a reliable choice for treating tuberculosis. Additionally, this drug undergoes various metabolic transformations, ensuring optimal efficacy. Don't let tuberculosis hold you back - choose 6-Fluoro-3-indoxyl-beta-D-galactopyranoside for a brighter future.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LPPR2 antibody, catalog no. 70R-7178</p>

<p>Keratin K1 antibody was raised in Guinea Pig using synthetic peptide of human keratin K1 coupled to KLH as the immunogen.</p>

<p>Rabbit polyclonal RAGE antibody (HRP)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of IRX3 antibody, catalog no. 20R-1124</p>

<p>Rabbit polyclonal FRA2 antibody</p>

<p>KCTD17 antibody was raised using the middle region of KCTD17 corresponding to a region with amino acids YGSEDQAEFLCVVSKELHSTPNGLSSESSRKTKSTEEQLEEQQQQEEEVE</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FAM92B antibody, catalog no. 70R-3362</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC37A4 antibody, catalog no. 70R-6793</p>

<p>The Sufu antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and bind to the Sufu protein, which plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be effective in detecting Sufu expression levels in different tissue types.</p>

<p>Purified recombinant E.coli cysH protein</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC25A14 antibody, catalog no. 70R-1750</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CERKL antibody, catalog no. 70R-9906</p>

<p>XPO5 antibody was raised in rabbit using the N terminal of XPO5 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PILRA antibody, catalog no. 70R-7024</p>

<p>MMP1 antibody was raised in mouse using a synthetic peptide (VQGQNVLHGYPKDIYSSFG) corresponding to amino acid residues 332-350 0f human MMP-1 as the immunogen.</p>

<p>Rabbit anti-goat IgG (biotin) was raised in rabbit using goat IgG F(ab')2 fragment as the immunogen.</p>

<p>Human Albumin protein is a versatile protein that plays a crucial role in various biological processes. It is commonly used in immunoassays and research applications due to its high reactivity with monoclonal antibodies. Human Albumin protein can be used as a standard or control in antigen-antibody reactions, making it an essential component in many diagnostic tests. In addition to its diagnostic applications, Human Albumin protein has been shown to have therapeutic potential. Studies have demonstrated its ability to promote the growth and differentiation of cardiomyocytes and mesenchymal stem cells, making it valuable for regenerative medicine research. Human Albumin protein has also been investigated for its potential protective effects against certain drugs, such as doxorubicin, which can cause cardiotoxicity. Furthermore, Human Albumin protein has been found to interact with various molecules involved in immune responses, including autoantibodies and chemokines. This interaction highlights its role in modulating immune system function and suggests its potential as a</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ALKBH1 antibody, catalog no. 70R-10379</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RECQL5 antibody, catalog no. 70R-4612</p>

<p>Rabbit polyclonal ARHGEF18 antibody (HRP)</p>

<p>1-186 amino acids: MTEYKLVVVG AGGVGKSALT IQLIQNHFVD EYDPTIEDSY RKQVVIDGET CLLDILDTAG QEEYSAMRDQ YMRTGEGFLC VFAINNSKSF ADINLYREQI KRVKDSDDVP MVLVGNKCDL PTRTVDTKQA HELAKSYGIP FIETSAKTRQ GVEDAFYTLV REIRQYRMKK LNSSDDGTQG CMGLPC</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PITPNB antibody, catalog no. 70R-3832</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ANKRD11 antibody, catalog no. 70R-1045</p>

<p>PLAT antibody was raised using the middle region of PLAT corresponding to a region with amino acids TVILGRTYRVVPGEEEQKFEVEKYIVHKEFDDDTYDNDIALLQLKSDSSR</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TMPRSS3 antibody, catalog no. 70R-3257</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KIF25 antibody, catalog no. 70R-1615</p>

<p>VPS16 antibody was raised in rabbit using the middle region of VPS16 as the immunogen</p>

<p>Rabbit polyclonal NCoA2 antibody</p>

<p>Purified Polyclonal SHPTP2 antibody</p>

<p>Lysozyme protein is a versatile enzyme that plays a crucial role in various biological processes. It acts as an epidermal growth factor and hormone peptide, contributing to cell proliferation and differentiation. Lysozyme also exhibits neuroprotective properties by preventing the accumulation of dopamine, which can lead to neuronal damage when activated excessively.</p>

<p>Cyclin N-Terminal Domain Containing 1 antibody was raised using the N terminal of CNTD1 corresponding to a region with amino acids QNEQAVREASGRLGRFREPQIVEFVFLLSEQWCLEKSVSYQAVEILERFM</p>

<p>Rabbit Polyclonal DARPP32 antibody (Thr75)</p>

<p>Purified Rabbit polyclonal CSFR antibody (Tyr699)</p>

<p>The Ephrin-B2 antibody is a polyclonal antibody that specifically targets the ephrin-B2 protein. This protein plays a crucial role in various biological processes, including cell adhesion, migration, and angiogenesis. The Ephrin-B2 antibody is widely used in life sciences research to study the function and regulation of ephrin-B2.</p>

<p>CMV pp52 protein is a highly activated chemokine that plays a crucial role in various Life Sciences applications. It has been extensively studied for its antiviral properties and biochemical functions. CMV pp52 protein is known to inhibit hemolysis and neutralize the effects of lipid peroxidation, making it an important component in antiviral research. This protein can be used in hybridization studies, where it binds to specific targets to facilitate detection and analysis. Additionally, CMV pp52 protein is commonly used as a target for monoclonal antibodies and interferon-based therapies. Its interaction with streptavidin and lipoprotein lipase further expands its potential applications in Proteins and Antigens research.</p>

<p>Purified recombinant Human RAB31 Protein (His tag)</p>

<p>Amylin antibody is a polyclonal antibody used in the field of Life Sciences. It specifically targets glucagon, an important hormone involved in regulating blood sugar levels. By binding to and neutralizing glucagon, this antibody helps to control glucose metabolism and maintain stable blood sugar levels.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TPI1 antibody, catalog no. 70R-2004</p>

<p>FADD antibody was raised in Rabbit using Human FADD as the immunogen</p>

<p>The Actin antibody is a highly specialized monoclonal antibody that targets actin, a key protein involved in various cellular processes. This antibody has been extensively studied and proven to have neutralizing properties against interferon and fatty acid-induced cytotoxicity. It is widely used in Life Sciences research, particularly in studies related to actin filaments and their role in cell structure and function.</p>

<p>The OCT4 antibody is a monoclonal antibody that acts as a family kinase inhibitor. It is widely used in Life Sciences research to study the expression and function of OCT4, a transcription factor involved in embryonic stem cell pluripotency. This antibody specifically recognizes and binds to OCT4 protein, allowing for its detection and analysis in various biological samples. It has been extensively validated and shown to have high sensitivity and specificity.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FCRLA antibody, catalog no. 70R-7201</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PDE3B antibody, catalog no. 70R-6283</p>

<p>Affinity purified Rabbit polyclonal PLA2G3 antibody</p>

<p>Rabbit polyclonal ADCK5 antibody</p>

<p>CALML3 antibody was raised in rabbit using the middle region of CALML3 as the immunogen</p>

<p>FOXM1 antibody was raised in Rabbit using Human FOXM1 as the immunogen</p>

<p>MITF antibody was raised in Rabbit using Human MITF as the immunogen</p>

<p>Purified Horse IgG HRP conjugate</p>

<p>Urochloralic Acid Conjugate for use in immunoassays</p>

<p>IL17F antibody was raised in Rabbit using Human IL17F as the immunogen</p>

<p>Affinity purified Rabbit polyclonal SSA1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of IL5 antibody, catalog no. 70R-6233</p>

<p>Purified Polyclonal Caspase 3 p17 antibody</p>

<p>RFP2 antibody was raised in rabbit using the middle region of RFP2 as the immunogen</p>

<p>The SRR antibody is a highly effective neutralizing agent that targets glucose-6-phosphate, histidine, ketamine, and other biomolecules. This monoclonal antibody has been specifically designed to bind to activated cells and inhibit their growth. It has cytotoxic properties that make it an ideal candidate for use in life sciences research and biomaterials development. The SRR antibody has shown promising results in inhibiting the activity of growth factors such as sclerostin and epidermal growth factor. With its unique specificity and potent effects, this antibody is a valuable tool for scientists and researchers in various fields.</p>

<p>The beta Amyloid antibody is a highly effective and versatile product that offers a range of benefits in the field of Life Sciences. It is a Polyclonal Antibody that has been specifically designed to target and neutralize the beta-amyloid protein, which is associated with neurodegenerative diseases such as Alzheimer's.</p>

<p>Purified recombinant RGS10 protein</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NUP35 antibody, catalog no. 70R-2173</p>

<p>AP2B1 antibody was raised using the middle region of AP2B1 corresponding to a region with amino acids SETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEVVLSEKP</p>

<p>USP9Y antibody was raised in rabbit using the C terminal of USP9Y as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KIAA1754L antibody, catalog no. 70R-6820</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NUP155 antibody, catalog no. 70R-2127</p>

<p>This antibody reacts with heavy chains on human IgG (gamma chain).</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GOLGB1 antibody, catalog no. 70R-6855</p>

Naltrexone Conjugate for use in immunoassays

<p>Purified recombinant Human HARS protein</p>

<p>RAPGEF3 antibody was raised using a synthetic peptide corresponding to a region with amino acids HGKVVLVLERASQGAGPSRPPTPGRNRYTVMSGTPEKILELLLEAMGPDS</p>

<p>The TrkA antibody is a polyclonal antibody that targets the growth factor receptor TrkA. It is commonly used in life sciences research and is valuable for studying various cellular processes. This antibody specifically binds to the amino-terminal region of TrkA and can be used for applications such as immunohistochemistry, Western blotting, and ELISA.</p>

<p>Region of Fractalkine protein corresponding to amino acids QHHGVTKCNI TCSKMTSKIP VALLIHYQQN QASCGKRAII LETRQHRLFC ADPKEQWVKD AMQHLDRQAA ALTRNG.</p>

<p>GABRG2 antibody was raised in Rabbit using Human GABRG2 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of WBP2NL antibody, catalog no. 70R-2017</p>

<p>Recombinant human IL-10 protein (His tag)</p>

<p>RTN3 antibody was raised in Mouse using a purified recombinant fragment of RTN3 expressed in E. coli as the immunogen.</p>

<p>KLK-B1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VLTAAHCFDGLPLQDVWRIYSGILNLSDITKDTPFSQIKEIIIHQNYKVS</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Rbm3 antibody, catalog no. 70R-8474</p>

<p>The CYP2A6 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is specifically designed to target and bind to the CYP2A6 protein complex, which plays a crucial role in metabolizing various substances in the human body. This antibody has been extensively tested and proven to effectively inhibit the enzymatic activity of CYP2A6.</p>

<p>Rabbit polyclonal NOMO1 antibody</p>

<p>CYP4A22 antibody was raised using the N terminal of CYP4A22 corresponding to a region with amino acids  MSVSVLSPSRRLGGVSGILQVTSLLILLLLLIKAAQLYLHRQWLLKALQQ</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LBX2 antibody, catalog no. 70R-8694</p>

<p>NOL3 antibody was raised in rabbit using the middle region of NOL3 as the immunogen</p>

<p>Purified Polyclonal RAB38 antibody</p>

<p>DAZAP1 antibody was raised using the C terminal of DAZAP1 corresponding to a region with amino acids LAFPPPPSQAAPDMSKPPTAQPDFPYGQYAGYGQDLSGFGQGFSDPSQQP</p>

<p>TAF7L antibody was raised in rabbit using the middle region of TAF7L as the immunogen</p>

<p>The SOD1 antibody is a monoclonal antibody that specifically targets the erythropoietin receptor. It plays a crucial role in neutralizing superoxide, which is a harmful reactive oxygen species. This antibody can be used in various applications, including research and diagnostics.</p>

<p>Rabbit polyclonal PPP1R11 antibody (HRP)</p>

<p>Affinity purified Rabbit polyclonal GPR62 antibody</p>

<p>CHD9 antibody was raised in Rabbit using Human CHD9 as the immunogen</p>

<p>TM9SF1 antibody was raised using the middle region of TM9SF1 corresponding to a region with amino acids THTYSVRWSETSVERRSDRRRGDDGGFFPRTLEIHWLSIINSMVLVFLLV</p>

<p>PSG9 antibody was raised using the N terminal of PSG9 corresponding to a region with amino acids YSNASLLIQNVTRKDAGTYTLHIIKRGDETREEIRHFTFTLYLETPKPYI</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RUFY1 antibody, catalog no. 70R-2737</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of UGT1A6 antibody, catalog no. 70R-7546</p>

<p>Region of MCP2 protein corresponding to amino acids  QPDSVSIPIT CCFNVINRKI PIQRLESYTR ITNIQCPKEA VIFKTKRGKE VCADPKERWV RDSMKHLDQI FQNLKP.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LOXL4 antibody, catalog no. 70R-10079</p>

<p>ZNF117 antibody was raised in rabbit using the middle region of ZNF117 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PCDHGA4 antibody, catalog no. 70R-6139</p>

<p>The p70S6 Kinase antibody is a highly effective Life Sciences product that serves as an essential tool for researchers and scientists. This antibody is designed to specifically target and bind to the p70S6 kinase, an enzyme involved in cell growth and proliferation. By inhibiting the activity of this kinase, the antibody can effectively regulate various cellular processes.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RELB antibody, catalog no. 20R-1128</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FBXL16 antibody, catalog no. 70R-3781</p>

<p>SOD1 antibody was raised using the N terminal of SOD1 corresponding to a region with amino acids MATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHE</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FLJ14154 antibody, catalog no. 70R-2380</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ADARB1 antibody, catalog no. 70R-1550</p>

<p>Mouse monoclonal SDR9C7 antibody</p>

<p>RAG2 antibody was raised in Mouse using a purified recombinant fragment of human RAG2(350-527aa) expressed in E. coli as the immunogen.</p>

<p>Rabbit polyclonal Cortactin antibody (Tyr421)</p>

<p>FBXO15 antibody was raised using the N terminal of FBXO15 corresponding to a region with amino acids QDKEAGYWKKEYITKQIASVKAALADILKPVNPYTGLPVKTKEALRIFGL</p>

<p>MPV17L antibody was raised using the N terminal of MPV17L corresponding to a region with amino acids MAGWWPALSRAARRHPWPTNVLLYGSLVSAGDALQQRLQGREANWRQTRR</p>

<p>Goat anti-mouse IgG/IgA/IgM (H+L) (Alk Phos) was raised in goat using murine IgG, IgA and IgM whole molecule as the immunogen.</p>

<p>ARHGAP26 antibody was raised in Rabbit using Human ARHGAP26 as the immunogen</p>

<p>The Nkx2.5 antibody is a powerful tool used in life sciences research. It is a polyclonal antibody that specifically targets the Nkx2.5 protein, which plays a crucial role in heart development and function. This antibody has been extensively tested and proven to be highly effective in various applications.</p>

<p>Purified recombinant Dengue VLP protein (Serotype 3) (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PNKP antibody, catalog no. 70R-4477</p>

<p>The SOX17 antibody is a monoclonal antibody used in Life Sciences research. It plays a crucial role in various biological processes, including the regulation of gene expression and the development of different cell types. This antibody specifically targets SOX17, a transcription factor that is involved in the differentiation of adipocytes and the regulation of insulin signaling.</p>

<p>22-98 amino acids: MASMTGGQQM GRGSHMGTND AEDCCLSVTQ KPIPGYIVRN FHYLLIKDGC RVPAVVFTTL RGRQLCAPPD QPWVERIIQR LQRTSAKMKR RSS</p>

<p>Purified Polyclonal LMTK2 antibody</p>

<p>The AKT2 antibody is a powerful tool used in life sciences research. It specifically targets the protein kinase AKT2, which plays a crucial role in various cellular processes. This antibody is highly specific and can effectively detect activated AKT2 in samples.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TRAK1 antibody, catalog no. 70R-9271</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF610 antibody, catalog no. 70R-8151</p>

<p>This antibody reacts with heavy chains on human IgE (epsilon chain).</p>

<p>Purified STOX2 Antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LSM1 antibody, catalog no. 70R-4947</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TUT1 antibody, catalog no. 70R-7980</p>

<p>Rabbit polyclonal POLR2I antibody</p>

<p>ILVBL antibody was raised in Rabbit using Human ILVBL as the immunogen</p>

<p>Rabbit polyclonal PFDN5 antibody</p>

<p>Bend6 antibody was raised in rabbit using the C terminal of Bend6 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RBM22 antibody, catalog no. 70R-4781</p>

<p>The NFAT3 antibody is a monoclonal antibody that specifically targets the nuclear factor of activated T-cells 3 (NFAT3). NFAT3 is a transcription factor that plays a crucial role in various cellular processes, including cell growth, differentiation, and apoptosis. This antibody binds to NFAT3 and inhibits its activity, leading to downstream effects on gene expression.</p>

<p>Rabbit polyclonal cJun antibody</p>

<p>DEFA1 antibody was raised in Rabbit using Human DEFA1 as the immunogen</p>

<p>Purified Polyclonal PI3K C2 gamma antibody</p>

<p>Rabbit polyclonal PABPC3 antibody</p>

<p>Procainamide Conjugate for use in immunoassays</p>

<p>Rabbit polyclonal ATP6E antibody</p>

<p>The IL4 antibody is a pegylated monoclonal antibody that is used in the field of Life Sciences as a medicament. It has been extensively studied for its glycation properties, particularly in human serum. The IL4 antibody can be immobilized onto a carbon electrode and used in electrochemical detection methods. It has also been used in conjunction with adeno-associated viruses to deliver therapeutic antibodies directly to specific cells or tissues. Additionally, the IL4 antibody has been shown to bind to actin filaments and can be labeled with phalloidin for visualization purposes. With its wide range of applications and specificity, the IL4 antibody is a valuable tool in various research fields.</p>

<p>1-166 amino acids: MGSSHHHHHH SSGLVPRGSH MASGVAVSDG VIKVFNDMKV RKSSTPEEVK KRKKAVLFCL SEDKKNIILE EGKEILVGDV GQTVDDPYAT FVKMLPDKDC RYALYDATYE TKESKKEDLV FIFWAPESAP LKSKMIYASS KDAIKKKLTG IKHELQANCY EEVKDRCTLA EKLGGSAVIS LEGKPL</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HIRIP3 antibody, catalog no. 70R-2185</p>

<p>Region of Sonic Hedgehog protein corresponding to amino acids IVIGPGRGFG KRRHPKKLTP LAYKQFIPNV AEKTLGASGR YEGKISRNSE RFKELTPNYN PDIIFKDEEN TGADRLMTQR CKDKLNALAI SVMNQWPGVK LRVTEGWDED GHHSEESLHY EGRALDITTS DRDRSKYGML ARLAVEAGFD WVYYESKAHI HCSVKAENSV AAKSGG.</p>

<p>Rabbit polyclonal BUB3 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ST3GAL5 antibody, catalog no. 70R-1878</p>

<p>ENO1 antibody was raised in Rabbit using Human ENO1 as the immunogen</p>

<p>5730409E04Rik antibody was raised in rabbit using the C terminal of 5730409E04Rik as the immunogen</p>

<p>Albuterol (powder) is a cytotoxic compound that has been extensively studied for its potential therapeutic applications. It has been shown to inhibit the expression of c-myc, a gene that is often overexpressed in cancer cells. Albuterol can also neutralize the activity of certain antibodies, including monoclonal antibodies, which makes it a valuable tool in the field of Biological Reagents. Additionally, albuterol has been found to have anti-mesothelin properties, making it a potential candidate for targeted therapy against mesothelioma. This compound is commonly used as a Chemical Reference in research laboratories and is widely utilized in various Life Sciences applications. Moreover, albuterol has been shown to activate β-catenin, a key regulator of cell growth and differentiation, and stimulate endothelial growth factor production. However, it's important to note that albuterol may cause thrombocytopenia, a condition characterized by low levels of platelets</p>

<p>C330003B14RIK antibody was raised in rabbit using the N terminal of C330003B14RIK as the immunogen</p>

<p>MIP antibody was raised in Rabbit using Human MIP as the immunogen</p>

<p>The Aminoacylase 1 antibody is a highly active agent that targets glycogen synthase kinase. It falls under the category of Life Sciences and is classified as a Polyclonal Antibody. This antibody has been shown to activate oxygen uptake and is commonly used in the field of medicine. It serves as a serum marker and is particularly effective in high-flux assays. The Aminoacylase 1 antibody can also be used in conjunction with other antibodies such as anti-mesothelin or interferon-stimulated gene antibodies. Additionally, it has been found to have methyl transferase properties. With its wide range of applications, this antibody is an invaluable tool for researchers in various scientific disciplines.</p>

<p>Mouse monoclonal HIV1 p17 Antibody; immunogen Bacterially expressed, hexahistidine amino-terminal tagged HIV-1 p17 Gag protein (clade B, HXB-3 isolate).</p>

<p>The AMH Recombinant Protein is a versatile product with a wide range of applications in the field of Life Sciences. This protein exhibits fibronectin-like properties, making it an excellent candidate for use in multidrug delivery systems. Additionally, it acts as a growth factor and chemokine, stimulating cellular proliferation and migration.</p>

<p>Purified recombinant Rotavirus VP4 protein (His tag)</p>

<p>Rabbit polyclonal p97 MAPK antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC11A1 antibody, catalog no. 70R-1781</p>

<p>MGC51025 antibody was raised in rabbit using the C terminal of MGC51025 as the immunogen</p>

<p>This antibody reacts with heavy chains on human IgG (gamma chain) and light chains on all human immunoglobulins.</p>

<p>The SYN1 antibody is a highly specialized immunoassay tool used in Life Sciences research. It is a polyclonal antibody that specifically targets SYN1, a protein involved in natriuretic signaling pathways. This antibody can be used in various applications such as Western blotting, immunohistochemistry, and enzyme-linked immunosorbent assays (ELISA). The SYN1 antibody is designed to detect the presence of SYN1 in pharmaceutical preparations and biological samples. It can be used to study the role of SYN1 in different cellular processes, including dopamine release, hypoxia-inducible factor-1 activation, and cytochrome P450 oxidoreductase activity. Researchers can use this antibody to investigate the effects of rapamycin treatment on SYN1 expression and function. With its high specificity and sensitivity, the SYN1 antibody is an invaluable tool for scientists studying the intricate mechanisms of cellular signaling pathways.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DPP10 antibody, catalog no. 70R-6500</p>