Bioquímicos e reagentes

<p>Mouse monoclonal 160 kDa Neurofilament antibody</p>

<p>MCP1 antibody was raised in Mouse using a purified recombinant fragment of human MCP-1 expressed in E. coli as the immunogen.</p>

<p>The CD248 antibody is a monoclonal antibody that specifically targets and binds to the CD248 protein. This protein is also known as endosialin or tumor endothelial marker 1 (TEM1). CD248 is activated by calpain and taxol inhibitors, and it plays a crucial role in various biological processes, including cell adhesion, migration, and angiogenesis.</p>

<p>OXTR antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>MGAT3 antibody was raised in Rabbit using Human MGAT3 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SIRT7 antibody, catalog no. 70R-7917</p>

<p>Region of FGF acidic protein corresponding to amino acids MFNLPLGNYK KPKLLYCSNG GHFLRILPDG TVDGTRDRSD QHIQLQLSAE SAGEVYIKGT ETGQYLAMDT EGLLYGSQTP NEECLFLERL EENHYNTYTS KKHAEKNWFV GLKKNGSCKR GPRTHYGQKA ILFLPLPVSS D.</p>

<p>Rabbit polyclonal EGR1/2 antibody</p>

<p>Complement C8b antibody was raised using the middle region of C8B corresponding to a region with amino acids WKPGSSGPGSTGSWNSGSSGTGSTGNQNPGSPRPGSTGTWNPGSSERGSA</p>

<p>The MMP7 antibody is a polyclonal antibody that belongs to the category of Life Sciences. It is specifically designed to target and neutralize the activity of matrix metalloproteinase 7 (MMP7). This antibody has been shown to be highly effective in inhibiting the activation of fibrinogen and potassium channels, which are crucial for various biological processes. The MMP7 antibody is produced from hybridoma cells, ensuring its high specificity and potency. It can be used as a medicament for treating diseases associated with abnormal MMP7 activity, such as cancer, inflammatory disorders, and cardiovascular diseases. Additionally, this antibody has been found to have neutralizing effects on chemokines and growth factors, further highlighting its therapeutic potential. With its exceptional binding affinity to MMP7 and its ability to block key enzymatic activities, the MMP7 antibody is a valuable tool in research and clinical applications related to protease biology and disease mechanisms.</p>

<p>PRRG2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RCSWEEAREYFEDNTLTERFWESYIYNGKGGRGRVDVASLAVGLTGGILL</p>

<p>OMA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids WAICPRDSLALLCQWIQSKLQEYMFNRPYSRKLEAEADKIGLLLAAKACA</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KLHDC9 antibody, catalog no. 70R-4006</p>

<p>The LTA4H antibody is a monoclonal antibody that is used in the field of Life Sciences. It is designed to target and bind to LTA4H, an enzyme involved in the metabolism of fatty acids. This antibody has a low density and is highly specific, making it an ideal tool for research and diagnostic purposes. The LTA4H antibody can be used in various applications, including immunoassays, Western blotting, immunohistochemistry, and flow cytometry. It is produced using advanced nanocomposite technology, which ensures high purity and stability. This antibody is supplied with all necessary excipients and can be easily activated for use in different experimental setups. In addition to its research applications, the LTA4H antibody has also shown potential as an antiviral agent against certain viral infections.</p>

<p>Rabbit polyclonal RPL28 antibody</p>

<p>GSK 2256294A is a diazonium salt that is used to treat bowel diseases. It has been shown to inhibit the production of fatty acid metabolites, such as epoxyeicosatrienoic acids (EETs), and reduce the number of autophagy-positive cells in diabetic patients. This molecule also has cancer-fighting properties and can be used to treat various types of cancers, including colon cancer, breast cancer, and prostate cancer. GSK 2256294A is currently undergoing preclinical studies for treatment of inflammatory bowel disease, cardiovascular disease, and liver disease.</p>

<p>The CD3E antibody is a mouse monoclonal antibody that specifically targets the CD3E protein. This antibody has phosphatase activity and can be used for cytotoxic assays. It works by binding to the CD3E antigen on the surface of cells, leading to an antigen-antibody reaction. The CD3E antibody is commonly used in research and diagnostic applications, such as immunoassays and delta-9-tetrahydrocannabinol detection methods. It is buffered for stability and can be used with other antibodies, including polyclonal antibodies, to enhance detection sensitivity. This monoclonal antibody is widely used in life sciences research and has been validated for use in various applications, including flow cytometry, immunohistochemistry, and Western blotting. Its high affinity for the CD3E protein makes it a valuable tool for studying immune responses and cell signaling pathways.</p>

<p>Mouse monoclonal CD19 antibody (biotin)</p>

<p>This antibody reacts with kappa light chains on human immunoglobulins.</p>

<p>Syntrophin Gamma 1 antibody was raised using the middle region of SNTG1 corresponding to a region with amino acids RFSQYVPGTDLSRQNAFQVIAVDGVCTGIIQCLSAEDCVDWLQAIATNIS</p>

<p>Mouse monoclonal NDUFB9 antibody</p>

<p>This antibody reacts with heavy chains on human IgG (gamma chain).</p>

<p>RAVER1 antibody was raised using the middle region of RAVER1 corresponding to a region with amino acids ALLQLALQTQGQKKPGILGDSPLGALQPGAQPANPLLGELPAGGGLPPEL</p>

<p>HPDL antibody was raised in Rabbit using Human HPDL as the immunogen</p>

<p>Rotavirus grade 3 Antigen. Taxonomy: Rheoviridae/Rotavirus/Rotavirus A/Simian rotavirus SA11. Virions consist of a capsid, a core, and a nucleoprotein complex. Virus capsid is not enveloped. Capsid/nucleocapsid is isometric with icosahedral symmetry and has a diameter of 80 nm. The genome is segmented and consists of eleven segments of linear double-stranded RNA. Rotavirus is the most common cause of severe diarrhea among children.</p>

<p>The SIAH1 Blocking Peptide is a high-quality product offered by Life Sciences. This peptide is commonly used in the field of Peptides and Biochemicals for its exceptional ability to neutralize TGF-beta in human serum. It contains a unique disulfide bond structure that ensures its stability and effectiveness.</p>

<p>CD3e antibody was raised in rat using CD3e as the immunogen.</p>

<p>The SPIC antibody is a highly specialized polyclonal antibody that targets endothelial growth factor. It is commonly used in the field of Life Sciences for research purposes. This antibody specifically binds to tyrosine residues on the endothelial growth factor, neutralizing its activity and preventing further growth stimulation. The SPIC antibody has shown promising results in inhibiting the growth of various types of cells, including those expressing the circumsporozoite protein and glucagon receptors. Additionally, it exhibits neurotrophic and neuroprotective effects, making it a valuable tool for studying neuronal development and regeneration. With its high specificity and affinity, the SPIC antibody is an essential component in many research projects focused on understanding growth factors and their role in various biological processes.</p>

<p>Rabbit polyclonal CCDC102A antibody</p>

<p>The TUBA1C antibody is a hormone peptide that acts as an inhibitory factor. It is a cytotoxic antibody that targets antiphospholipid antibodies in the human serum. This monoclonal antibody has been shown to inhibit the activity of interferon, dopamine, and leukemia inhibitory factor. Additionally, it has been found to possess anticoagulant properties. The TUBA1C antibody is a highly specific and potent inhibitor that can be used in various research and clinical applications. Its unique characteristics make it an essential tool for studying autoimmune disorders and developing targeted therapies.</p>

<p>The p35 antibody is a monoclonal antibody that is widely used in the field of Life Sciences. It specifically targets actin filaments and has been extensively studied for its role in various cellular processes. This antibody has shown high specificity and affinity towards actin, making it an essential tool for researchers studying actin dynamics and cytoskeletal organization.</p>

<p>The WNT16 antibody is a highly reactive polyclonal and monoclonal antibody that specifically binds to antigen binding molecules. It has been extensively studied in the field of Life Sciences for its role in various biological processes. The WNT16 antibody has shown to inhibit the activity of phosphatase, interleukin-6, and cysteine-rich proteins, which are involved in important cellular signaling pathways. Additionally, it has been found to exhibit cytotoxic effects on human serum and can block the transmembrane conductance of certain chemokines. With its high specificity and potent inhibitory properties, the WNT16 antibody is a valuable tool for researchers studying activated signaling pathways and exploring potential therapeutic targets.</p>

<p>FGF10 antibody was raised in goat using highly pure recombinant human FGF-10 as the immunogen.</p>

<p>HEPACAM antibody was raised in Rabbit using Human HEPACAM as the immunogen</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known to effectively treat tuberculosis infections due to its bactericidal activity. This active compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its high frequency of human activity has been demonstrated using a patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>The EDNRA antibody is a polyclonal antibody that has been extensively studied and widely used in various applications. It is commonly used in CDNA microarray experiments to analyze gene expression profiles and identify potential biomarkers. The EDNRA antibody specifically targets the endothelin receptor type A (EDNRA), which plays a crucial role in cellular immunotherapy and the development of targeted therapies for various diseases.</p>

<p>PSMC6 antibody was raised in rabbit using the C terminal of PSMC6 as the immunogen</p>

<p>LRRC2 antibody was raised using the N terminal of LRRC2 corresponding to a region with amino acids GHKVVVFDISVIRALWETRVKKHKAWQKKEVERLEKSALEKIKEEWNFVA</p>

<p>The TRPV4 antibody is a highly specialized monoclonal antibody that targets the transient receptor potential vanilloid 4 (TRPV4) channel. This channel plays a crucial role in various physiological processes, including natriuretic regulation, fibrinogen production, and cellular response to mechanical stress. The TRPV4 antibody has been extensively tested in human serum and has shown excellent specificity and sensitivity in detecting TRPV4 expression.</p>

<p>The HA Tag antibody is a highly specific monoclonal antibody that is widely used in Life Sciences research. It is designed to specifically bind to the HA (hemagglutinin) epitope, which is commonly fused to target molecules for various applications. The HA Tag antibody is commonly used in immunoassays and antigen binding experiments to detect and quantify the expression of target proteins.</p>

<p>USP38 antibody was raised in rabbit using the middle region of USP38 as the immunogen</p>

<p>PAPOLB antibody was raised using the middle region of PAPOLB corresponding to a region with amino acids MEEFRTMWVIGLGLKKPDNSEILSIDLTYDIQSFTDTVYRQAVNSKMFEM</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of COMT antibody, catalog no. 70R-7143</p>

<p>Rabbit polyclonal JunD antibody</p>

<p>Purified Polyclonal Cytochrome P450 3A4 antibody</p>

<p>Rabbit polyclonal TNFAIP8 antibody</p>

<p>The ROCK2 antibody is a protein that has neutralizing properties against collagen. It belongs to the class of polyclonal antibodies and is used in Life Sciences research. This antibody specifically targets ROCK2, which stands for Rho-associated coiled-coil containing protein kinase 2. ROCK2 is involved in various cellular processes, including cell proliferation, migration, and contraction. The ROCK2 antibody can be used for various applications such as immunohistochemistry, Western blotting, and enzyme-linked immunosorbent assays (ELISAs). It is available in both monoclonal and polyclonal forms. The antibody can be immobilized on chromatographic resins or used for protein-protein interaction studies. Additionally, it can be used to study the role of ROCK2 in hepatocyte growth factor signaling pathways or to investigate its binding partners such as angptl3 or growth factor binding proteins.</p>

<p>Rabbit polyclonal RPL9 antibody</p>

<p>Rabbit polyclonal EIF3S2 antibody</p>

<p>CCBL1 antibody was raised in Rabbit using Human CCBL1 as the immunogen</p>

<p>Purified recombinant MRM1 protein (His tag)</p>

<p>MBD1 antibody was raised using the middle region of MBD1 corresponding to a region with amino acids CKVWETEDTVEPTSTSWNPRGWPGTHVSLSPPPASMMWVSCRRSWCPSSQ</p>

<p>Licoflavone A is a natural sweetener with inhibitory activity against bacteria, fungi and viruses. It has been shown to have an activity index of 0.7-0.8. Licoflavone A inhibits the growth of many bacteria such as Staphylococcus aureus, Escherichia coli, Streptococcus pneumoniae, Klebsiella pneumoniae, Salmonella enterica and Pseudomonas aeruginosa by binding to the enzyme PTP1B. The compound also inhibits phosphatase activity in echinatin and glycyrrhiza species and has been found to be active against influenza virus in vitro. Licoflavone A displays antioxidant properties by inhibiting lipid peroxidation in cells treated with hydrogen peroxide or other reactive oxygen species (ROS).</p>

<p>CYP27A1 antibody was raised in Rabbit using Human CYP27A1 as the immunogen</p>

<p>Mouse monoclonal PPARA antibody</p>

<p>FXYD5 antibody was raised using the middle region of FXYD5 corresponding to a region with amino acids DETPQPQTQTQQLEGTDGPLVTDPETHKSTKAAHPTDDTTTLSERPSPST</p>

<p>Mouse monoclonal RXRG antibody</p>

<p>Rabbit polyclonal AQP12 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of OR2D3 antibody, catalog no. 70R-9860</p>

<p>ERCC5 antibody was raised in Rabbit using Human ERCC5 as the immunogen</p>

<p>The ITGB4 antibody is a highly specialized biomolecule that acts as an inhibitor of growth factors. It specifically targets nuclear and nucleotide molecules, preventing them from activating certain cellular processes. This monoclonal antibody has been shown to have a high affinity for the tyrosine residues on the surface of cells, effectively blocking their interaction with growth factor receptors.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ALS2CR12 antibody, catalog no. 70R-3279</p>

<p>IL11R alpha antibody was raised using the middle region of IL11RA corresponding to a region with amino acids FLLKFRLQYRPAQHPAWSTVEPAGLEEVITDAVAGLPHAVRVSARDFLDA</p>

<p>Mouse monoclonal PRS3 antibody</p>

<p>Rabbit polyclonal PTK6 antibody</p>

<p>MCART6 antibody was raised using the middle region of MCART6 corresponding to a region with amino acids WPVLARNSLGSALYFSFKDPIQDGLAEQGLPHWVPALVSGSVNGTITCLV</p>

<p>RUNX3 antibody was raised in rabbit using the C terminal of RUNX3 as the immunogen</p>

<p>MMD2 antibody was raised using the N terminal of MMD2 corresponding to a region with amino acids FAPRLLDFQKTKYARFMNHRVPAHKRYQPTEYEHAANCATHAFWIIPSIL</p>

<p>Rabbit polyclonal PGM2L1 antibody</p>

<p>PPP1R13L antibody was raised in mouse using recombinant Human Protein Phosphatase 1, Regulatory (Inhibitor) Subunit 13 Like (Ppp1R13L)</p>

<p>The Canine Coronavirus protein is a protein complex that is found in human serum. It is used in the field of Life Sciences for various purposes, including research and diagnostics. This protein complex can be used as a tool to study the interaction between viruses and host cells, as well as to develop inhibitors and monoclonal antibodies for therapeutic use. The Canine Coronavirus protein has also been shown to have viscosity-enhancing properties, which makes it useful in applications such as the measurement of creatine kinase levels in blood samples. Additionally, this protein complex can be used as a growth factor and has been found to form dimers with other proteins such as chemokines and interleukin-6. Overall, the Canine Coronavirus protein is a versatile tool that plays a crucial role in understanding and advancing our knowledge in the field of Life Sciences.</p>

<p>The Cyclin H antibody is a highly specific monoclonal antibody that is used in Life Sciences research. It has been extensively tested and validated for its performance in various applications. This antibody is designed to target the cyclin H protein, which plays a crucial role in cell cycle regulation and growth factor signaling pathways.</p>

<p>The CD4 antibody is a monoclonal antibody that specifically targets the CD4 antigen. This antibody is widely used in life sciences research to study the role of CD4 in various biological processes. The CD4 antigen is a glycoprotein found on the surface of T-helper cells, and it plays a crucial role in immune system regulation.</p>

<p>CD4 antibody (PE) was raised in mouse using chicken CD4 as the immunogen</p>

<p>Region of MIA2 protein corresponding to amino acids MLESTKLLAD LKKCGDLECE ALINRVSAMR DYRGPDCRYL NFTKGEEISV YVKLAGERED LWAGSKGKEF GYFPRDAVQI EEVFISEEIQ MSTKESDFLC L.</p>

<p>CD28 antibody was raised in hamster using CD28 costimulatory receptor as the immunogen.</p>

<p>PEX11A antibody was raised using the middle region of PEX11A corresponding to a region with amino acids MKRVTCDRAKKEKSASQDPLWFSVAEEETEWLQSFLLLLFRSLKQHPPLL</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RNF133 antibody, catalog no. 70R-7337</p>

<p>MUC15 antibody was raised using the middle region of MUC15 corresponding to a region with amino acids KFTNNSKLFPNTSDPQKENRNTGIVFGAILGAILGVSLLTLVGYLLCGKR</p>

<p>C19ORF54 antibody was raised using the N terminal Of C19Orf54 corresponding to a region with amino acids MTSPCSPPLKPPISPPKTPVPQASSIPSPPLPPSPLDFSALPSPPWSQQT</p>

<p>DR1 antibody was raised in Rabbit using Human DR1 as the immunogen</p>

<p>The NUP62 antibody is a polyclonal antibody that specifically binds to NUP62, a protein involved in various cellular processes. This antibody can be used in life sciences research to study the role of NUP62 in different biological pathways. It has been shown to interact with other binding proteins and lipoprotein lipase, suggesting its involvement in lipid metabolism. Additionally, the NUP62 antibody has the ability to bind to cations and growth factors, indicating its potential role in signal transduction pathways. This antibody can also be used for the detection of autoantibodies in reactive conditions or as a diagnostic tool for diseases such as cancer. The NUP62 antibody is produced using advanced techniques and high-quality materials, ensuring reliable and reproducible results.</p>

<p>GRIK5 antibody was raised using the middle region of GRIK5 corresponding to a region with amino acids EDGLYGAPEPNGSWTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFM</p>

<p>ATP2A2 antibody was raised using the C terminal of ATP2A2 corresponding to a region with amino acids VNLVTDGLPATALGFNPPDLDIMNKPPRNPKEPLISGWLFFRYLAIGCYV</p>

<p>GPD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GQVELNEFLQLMSAIQKGRVSGSRLAILMKTAEENLDRRVPIPVDRSCGG</p>

<p>CRSP2 antibody was raised in mouse using recombinant Human Cofactor Required For Sp1 Transcriptional Activation, Subunit 2, 150Kda (Crsp2)</p>

<p>The SIRT1 antibody is a highly specialized antibody used in the field of Life Sciences. It specifically targets and binds to the SIRT1 protein, which is involved in various cellular processes such as epidermal growth factor signaling and histone deacetylation. This monoclonal antibody offers high specificity and sensitivity, making it an ideal tool for researchers studying the role of SIRT1 in different biological pathways.</p>

<p>This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.</p>

<p>Rabbit polyclonal CCL2 antibody (biotin)</p>

<p>The NUMB antibody is a monoclonal antibody derived from streptomyces. It has hypomethylating properties and is used in the field of life sciences for various applications. This antibody specifically targets and binds to NUMB, a protein involved in cell differentiation and development. The NUMB antibody has chemotherapeutic potential and has been studied for its ability to inhibit the growth of cancer cells. It can also be used in research settings for chromatographic and immunohistochemical studies. With its unique properties and specificity, the NUMB antibody offers promising avenues for further exploration in the field of molecular biology and therapeutics.</p>

<p>GRIN1 antibody was raised in Rabbit using Human GRIN1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PRRC1 antibody, catalog no. 70R-3262</p>

<p>Purified recombinant LYG2 protein (His tag)</p>

<p>CCND3 antibody was raised in Rabbit using Human CCND3 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Eif4e antibody, catalog no. 70R-9620</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the rifamycins class. It is specifically designed to target tuberculosis infection and contains active compounds that exhibit strong bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Extensive research has been conducted using a patch-clamp technique on human erythrocytes, confirming its high efficacy in humans. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it selectively binds to markers expressed at high levels in Mycobacterium tuberculosis strains and effectively inhibits cell growth in culture.</p>

<p>Mouse monoclonal CYB5R1 antibody</p>

<p>Mouse monoclonal IkBa antibody (N-terminus)</p>

<p>9-OH Risperidone chemical reference substance</p>

<p>Purified recombinant RPL11 protein (His tag)</p>

<p>PDHA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KDRMVNSNLASVEELKEIDVEVRKEIEDAAQFATADPEPPLEELGYHIYS</p>

<p>The Tyrosine Hydroxylase antibody is a specific antibody used in Life Sciences research. It is commonly used to study the cholinergic and dopamine systems in the brain. This antibody targets tyrosine hydroxylase, which is an enzyme involved in the synthesis of dopamine. By detecting and measuring levels of tyrosine hydroxylase, researchers can gain valuable insights into neurological disorders such as Parkinson's disease and schizophrenia.</p>

<p>Rabbit polyclonal PPP1R14A antibody</p>

<p>Purified recombinant GNAZ protein (His tag)</p>

<p>LARP6 antibody was raised using the middle region of LARP6 corresponding to a region with amino acids MGTQEKSPGTSPLLSRKMQTADGLPVGVLRLPRGPDNTRGFHGHERSRAC</p>

<p>POFUT2 antibody was raised using the C terminal of POFUT2 corresponding to a region with amino acids RFEPTWEELELYKDGGVAIIDQWICAHARCLPTSLSAESGSGGFQRFFCP</p>

<p>Purified Polyclonal ACOT8 antibody</p>

<p>The N cadherin antibody is a powerful tool in the field of Life Sciences. It plays a crucial role in various biological processes such as cell adhesion, differentiation, and migration. This antibody specifically targets N cadherin, a protein that is involved in cell-cell adhesion and signaling.</p>

<p>Purified Polyclonal 14 3 3 theta antibody</p>

<p>Purified recombinant Treponema pallidum protein</p>

<p>The Norovirus G2 antibody is a highly effective and specific monoclonal antibody that is widely used in immunoassays in the field of Life Sciences. This antibody has neutralizing properties, making it an essential tool for researchers studying norovirus infections. It targets the tyrosine kinase receptor on norovirus particles, preventing their attachment to host cells and subsequent infection.</p>

<p>25 tests included in 1 piece</p>

<p>Recombinant human TRPT1 protein (His tag)</p>

<p>EPCAM antibody was raised in Rabbit using Human EPCAM as the immunogen</p>

<p>The GluR1 antibody is a monoclonal antibody that specifically targets the GluR1 subunit of the glutamate receptor. It has been shown to be effective in various research applications, including neuroscience and neurobiology studies. The GluR1 antibody can be used to investigate the role of GluR1 in synaptic plasticity, learning and memory, and neuronal development.</p>

<p>Il36a protein is a growth factor that belongs to the family of chemokines. It plays a crucial role in various biological processes, including the regulation of immune responses and inflammation. Il36a protein is involved in the activation of dopamine receptors and has been shown to have atypical hemolytic effects on endothelial cells. This protein can be detected using monoclonal antibodies in human serum samples. Il36a protein also interacts with other proteins, such as phosphorylcholine and TNF-α, and may play a role in the regulation of growth hormone receptor activity. Its conjugated form has been studied extensively in life sciences research for its potential therapeutic applications.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NECAB3 antibody, catalog no. 70R-3494</p>

<p>LIN7C antibody was raised in Rabbit using Human LIN7C as the immunogen</p>

<p>1-453 amino acids: MGSSHHHHHH SSGLVPRGSH MSKISEAVKR ARAAFSSGRT RPLQFRIQQL EALQRLIQEQ EQELVGALAA DLHKNEWNAY YEEVVYVLEE IEYMIQKLPE WAADEPVEKT PQTQQDELYI HSEPLGVVLV IGTWNYPFNL TIQPMVGAIA AGNAVVLKPS ELSENMASLL ATIIPQYLDK DLYPVINGGV PETTELLKER FDHILYTGST GVGKIIMTAA AKHLTPVTLE LGGKSPCYVD KNCDLDVACR RIAWGKFMNS GQTCVAPDYI LCDPSIQNQI VEKLKKSLKE FYGEDAKKSR DYGRIISARH FQRVMGLIEG QKVAYGGTGD AATRYIAPTI LTDVDPQSPV MQEEIFGPVL PIVCVRSLEE AIQFINQREK PLALYMFSSN DKVIKKMIAE TSSGGVAAND VIVHITLHSL PFGGVGNSGM GSYHGKKSFE TFSHRRSCLV RPLMNDEGLK VRYPPSPAKM TQH</p>

<p>ATP5B antibody was raised using the C terminal of ATP5B corresponding to a region with amino acids MGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAEEH</p>

<p>Rat monoclonal CD4 antibody (PE); mouse target; IgG2b kappa; clone GK1.5</p>

<p>The Progesterone Receptor antibody is a polyclonal antibody that is used in life sciences research. It specifically targets the progesterone receptor, a protein involved in various physiological processes. This antibody has been shown to have anti-VEGF (vascular endothelial growth factor) activity, which makes it useful for studying angiogenesis and tumor growth. In addition, it has been used to detect the presence of the progesterone receptor in various cell types, including MCF-7 breast cancer cells. The Progesterone Receptor antibody is activated by binding to its target protein and can be used in a variety of assays, such as ELISA or immunohistochemistry. Its high specificity and affinity make it an essential tool for researchers studying hormone signaling pathways and related diseases.</p>

<p>Collagen Type II protein is a vital component of connective tissues, providing strength and support to various structures in the body. It plays a crucial role in maintaining healthy joints and cartilage. This protein has been extensively studied for its potential therapeutic applications.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PDE1C antibody, catalog no. 70R-2073</p>

<p>The IRAK1 antibody is a high-quality polyclonal antibody that specifically targets and binds to interleukin-1 receptor-associated kinase 1 (IRAK1). This antibody is crucial in life sciences research as it plays a vital role in the innate immune response. It has been extensively used to study the signaling pathways involved in inflammatory responses and autoimmune diseases.</p>

<p>Purified recombinant Human RGS19 protein</p>

<p>The BRaf antibody is a highly specific antibody used in various life science applications. It is commonly used to detect and measure the levels of BRaf protein in samples. This antibody has been extensively validated and shown to have high affinity and specificity for BRaf.</p>

<p>DPP9 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>DTX2 antibody was raised in Rabbit using Human DTX2 as the immunogen</p>

<p>Rabbit polyclonal TUSC4 antibody</p>

<p>This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.</p>

<p>CRH antibody was raised in Rabbit using Human CRH as the immunogen</p>

<p>FASTKD2 antibody was raised using the middle region of FASTKD2 corresponding to a region with amino acids DTNRNQVLPLSDVDTTSATDIQRVAVLCVSRSAYCLGSSHPRGFLAMKMR</p>

<p>M-Methyl atomoxetine hydrochloride is a chemical compound, classified as a pharmaceutical intermediate or research chemical. It is synthesized from atomoxetine, a selective norepinephrine reuptake inhibitor (NRI). The compound functions by inhibiting the transporter responsible for the reabsorption of norepinephrine, thus increasing its availability in the synaptic cleft.</p>

<p>ESR1 antibody was raised in rabbit using the C terminal of ESR1 as the immunogen</p>

<p>The PEA15 antibody is a polyclonal antibody that specifically targets interleukin-6 (IL-6), an inflammatory cytokine involved in various physiological processes. This antibody acts as an inhibitory factor for IL-6, preventing its activation and downstream signaling pathways. Additionally, the PEA15 antibody has been shown to have neutralizing effects on other proteins, such as epidermal growth factor (EGF) and glycine.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KCTD10 antibody, catalog no. 70R-1503</p>

<p>NUP62 antibody was raised using the N terminal of NUP62 corresponding to a region with amino acids SGFNFGGTGAPTGGFTFGTAKTATTTPATGFSFSTSGTGGFNFGAPFQPA</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GLYAT antibody, catalog no. 70R-2467</p>

<p>Rabbit anti-guinea pig IgG (H+L) (FITC) was raised in rabbit using guinea pig IgG whole molecule as the immunogen.</p>

<p>Perforin antibody was raised in mouse using purified granules from human YT lymphoma cell line as the immunogen.</p>

<p>Pnrc2 antibody was raised in rabbit using the N terminal of Pnrc2 as the immunogen</p>

<p>CFP antibody was raised using the N terminal of CFP corresponding to a region with amino acids QYEESSGKCKGLLGGGVSVEDCCLNTAFAYQKRSGGLCQPCRSPRWSLWS</p>

<p>ZNF468 antibody was raised in rabbit using the middle region of ZNF468 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of B3GALT6 antibody, catalog no. 70R-7242</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of UCHL5 antibody, catalog no. 70R-3208</p>

<p>TIMP1 protein is an inhibitory factor that plays a crucial role in various biological processes. It is widely used in the field of Life Sciences as a research tool and has applications in Proteins and Antigens studies. TIMP1 protein has been shown to be activated by adalimumab, a monoclonal antibody, and has neutralizing effects on TNF-α, a pro-inflammatory cytokine. Additionally, TIMP1 protein is involved in regulating collagen metabolism and angiogenesis through its interaction with angptl3. It can be used in electrode-based assays or as an antigenic peptide for the development of DNA vaccines or monoclonal antibodies. With its diverse applications and versatility, TIMP1 protein is an essential component in many research projects.</p>

<p>The IL21R protein is a monoclonal antibody that targets the epidermal growth factor (EGF) and belongs to the class of conjugated proteins. It has an EGF-like structure and exhibits cytotoxic and neutralizing effects against tumor necrosis factor-alpha (TNF-α). IL21R protein has been shown to be effective in combination with other therapies, such as adalimumab, for the treatment of various diseases. It can also be used in research and diagnostic applications, as it is a valuable tool for studying cellular signaling pathways and biomarkers. Additionally, IL21R protein has potential applications in gene therapy, as it can be delivered using adeno-associated viruses or incorporated into DNA vaccines. With its ability to modulate growth factors like TGF-beta, this protein holds promise in the field of life sciences for enhancing biomass production and promoting tissue regeneration.</p>

<p>Purified recombinant CARD17 protein (His tag)</p>

<p>GNAS antibody was raised using the N terminal of GNAS corresponding to a region with amino acids VYRATHRLLLLGAGESGKSTIVKQMRILHVNGFNGEGGEEDPQAARSNSD</p>

<p>Rabbit polyclonal PAK4/5/6 antibody</p>

<p>SPINT1 antibody was raised using the middle region of SPINT1 corresponding to a region with amino acids PFSEHCARFTYGGCYGNKNNFEEEQQCLESCRGISKKDVFGLRREIPIPS</p>

<p>Mouse monoclonal Toll-like receptor 2 antibody (biotin)</p>

<p>MRPS2 antibody was raised using the N terminal of MRPS2 corresponding to a region with amino acids MATSSAALPRILGAGARAPSRWLGFLGKATPRPARPSRRTLGSATALMIR</p>

<p>Rabbit polyclonal WRKY9 antibody</p>

<p>Syrian Hamster monoclonal IgG Isotype Control antibody (biotin)</p>

<p>METTL2B antibody was raised using the N terminal of METTL2B corresponding to a region with amino acids INAHKYWNDFYKIHENGFFKDRHWLFTEFPELAPSQNQNHLKDWFLENKS</p>

<p>RTN4 antibody was raised using the middle region of RTN4 corresponding to a region with amino acids RAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKFAV</p>

<p>Purified recombinant COX5B protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Abcb10 antibody, catalog no. 70R-8569</p>

<p>Adenovirus Type 2 protein is a versatile protein that has various applications in the field of Life Sciences. It is commonly used in research and diagnostic laboratories for its ability to generate antibodies through hybridoma cell lines. This protein can be used as a heterologous polypeptide to study the immune response or as an antigen to develop diagnostic tests.</p>

<p>CD49e antibody (Azide Free) was raised in rat using C57BL/6 x A/J F1 murine mast cell line MC/9 as the immunogen.</p>

<p>Purified Rabbit polyclonal OR4L1 antibody</p>

<p>The YAP antibody is a highly specialized product used in the field of Life Sciences. It is a monoclonal antibody that specifically targets and detects the Yes-associated protein (YAP). YAP is an important growth factor involved in various cellular processes, including cell proliferation and differentiation.</p>

<p>The HER2 antibody is a highly effective medicament that acts as an anti-HER2 antibody. It works by targeting the epidermal growth factor receptor HER2, which is overexpressed in certain types of cancer cells. This biochemical agent belongs to the class of monoclonal antibodies, similar to adalimumab and trastuzumab. The HER2 antibody has been extensively studied in the field of Life Sciences and has shown promising results in inhibiting tumor growth.</p>

<p>The OR51E1 antibody is a highly effective neutralizing agent used in Life Sciences research. It has been extensively tested and validated through electrophoresis techniques. This antibody specifically targets e-cadherin, fibrinogen, erythropoietin, chemokine, collagen, interleukin-6, and actin.</p>

<p>ALAS2 antibody was raised using the C terminal of ALAS2 corresponding to a region with amino acids VRLLKGEEGQALRRAHQRNVKHMRQLLMDRGLPVIPCPSHIIPIRVGNAA</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RFESD antibody, catalog no. 70R-4404</p>

<p>Goat anti Mouse Lambda Light Chain secondary antibody (HRP)</p>

<p>C12ORF4 antibody was raised using the N terminal Of C12Orf4 corresponding to a region with amino acids EESLSDYDRDAEASLAAVKSGEVDLHQLASTWAKAYAETTLEHARPEEPS</p>

<p>This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.</p>

<p>Tropomyosin 3 antibody was raised using the middle region of TPM3 corresponding to a region with amino acids TEERAELAESRCREMDEQIRLMDQNLKCLSAAEEKYSQKEDKYEEEIKIL</p>

<p>CLASP1 antibody was raised in Rat using alpha-CLASP1-N-terminus and GST fusion protein as the immunogen.</p>

<p>Mouse anti Human IgG antibody was raised in Mouse using Human IgG was isolated from human sera and purified by chromatography as the immunogen.</p>

<p>Opticin antibody was raised using the C terminal of OPTC corresponding to a region with amino acids LSDNLLDSIPGPLPLSLRSVHLQNNLIETMQRDVFCDPEEHKHTRRQLED</p>

<p>Purified Polyclonal RPL11 antibody</p>

<p>Mouse monoclonal FceRI alpha antibody</p>

<p>OCEL1 antibody was raised in rabbit using the C terminal of OCEL1 as the immunogen</p>