Bioquímicos e reagentes
Os bioquímicos e reagentes são substâncias fundamentais para a pesquisa e desenvolvimento em campos como biotecnologia, biologia molecular, farmacologia e medicina. Esses produtos são essenciais para uma variedade de aplicações, incluindo a síntese de compostos, a análise de amostras biológicas, a pesquisa de processos metabólicos e a produção de medicamentos. Na CymitQuimica, oferecemos uma ampla seleção de bioquímicos e reagentes de alta qualidade e pureza, adequados para diversas necessidades científicas e industriais. Nosso catálogo inclui enzimas, anticorpos, ácidos nucleicos, aminoácidos e muitos outros produtos, todos projetados para apoiar pesquisadores e profissionais em seus projetos de pesquisa e desenvolvimento, garantindo resultados confiáveis e reproduzíveis.
Subcategorias de "Bioquímicos e reagentes"
- Biomoléculas(99.130 produtos)
- Por Alvo Biológico(99.159 produtos)
- Por uso/Efeitos Farmacológicos(6.787 produtos)
- Compostos relacionados à criopreservação e aos crioconservantes(21 produtos)
- Desinfetantes, aditivos para aquecimento de líquidos de banho e compostos relacionados(28 produtos)
- Hormónios(346 produtos)
- Biologia Vegetal(6.747 produtos)
- Metabólitos secundários(14.222 produtos)
Foram encontrados 130579 produtos de "Bioquímicos e reagentes"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
dPEG®4 Biotin Acid
CAS:<p>dPEG®4 Biotin Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. dPEG®4 Biotin Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Pureza:Min. 95%Peso molecular:491.6 g/molNHS-dPEG®4 Biotin
CAS:<p>NHS-dPEG®4 Biotin is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. NHS-dPEG®4 Biotin is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Pureza:Min. 95%Peso molecular:588.67 g/molHydroxy-dPEG®8-t-Butyl Ester
CAS:<p>Hydroxy-dPEG®8-t-Butyl Ester is a PEG polymer categorised as monofunctional (OH-PEG-X). Used as a linker, hydroxy-dPEG®8-t-Butyl Ester is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.</p>Pureza:Min. 95%Peso molecular:498.6 g/molAmino-dPEG®24-t-Butyl Ester
CAS:<p>Amino-dPEG®24-t-Butyl Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Amino-dPEG®24-t-Butyl Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Fórmula:C18H36O10Pureza:Min. 95%Peso molecular:412.47 g/molMAL-dPEG®4-(m-dPEG®24)3
CAS:<p>MAL-dPEG®4-(m-dPEG®24)3 is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. MAL-dPEG®4-(m-dPEG®24)3 is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Fórmula:C23H40N4O12Pureza:Min. 95%Peso molecular:564.58 g/molm-dPEG®-Acid (MW = 412)
CAS:<p>m-dPEG®-Acid (MW = 412) is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. m-dPEG®-Acid (MW = 412) is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Pureza:Min. 95%Peso molecular:412.47 g/molLipoamido-dPEG®36-TFP Ester
CAS:<p>Lipoamido-dPEG®36-TFP Ester is a PEG molecule conjugated with a lipid moiety. Lipoamido-dPEG®36-TFP Ester, conjugated to this lipid constituent, is very important especially in drug delivery and vaccine development as it helps improve the stability and circulation time of lipid nanoparticles (LNPs) and liposomes.</p>Fórmula:C16H20N2O10Pureza:Min. 95%Peso molecular:400.34 g/molCBZ-N-Amido-dPEG®36-Acid
CAS:<p>CBZ-N-Amido-dPEG®36-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. CBZ-N-Amido-dPEG®36-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Fórmula:C83H157NO40Pureza:Min. 95%Peso molecular:1,809.12 g/molFmoc-N-Amido-dPEG®36-Acid
CAS:<p>Fmoc-N-Amido-dPEG®36-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Fmoc-N-Amido-dPEG®36-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Fórmula:C90H161NO40Pureza:Min. 95%Peso molecular:1,897.22 g/molAzido-dPEG®8-Acid
CAS:<p>Azido-dPEG®8-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Azido-dPEG®8-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Fórmula:C72H146N4O35Pureza:Min. 95%Peso molecular:1,627.94 g/molAmino-dPEG®4-(m-dPEG®8)3
CAS:<p>Amino-dPEG®4-(m-dPEG®8)3 is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Amino-dPEG®4-(m-dPEG®8)3 is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Fórmula:C178H346N6O86Pureza:Min. 95%Peso molecular:3,946.64 g/molBis-dPEG®4-Acid
CAS:<p>Bis-dPEG®4-Acid is a PEG polymer categorised as homobifunctional PEG (X-PEG X). Used as a linker, bis-dPEG®4-Acid is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.</p>Fórmula:C10H18O7Pureza:Min. 95%Peso molecular:250.25 g/molS-Acetyl-dPEG®12-OH
CAS:<p>S-Acetyl-dPEG®12-OH is a PEG polymer categorised as monofunctional (OH-PEG-X). Used as a linker, S-Acetyl-dPEG®12-OH is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.</p>Fórmula:C26H52O13SPureza:Min. 95%Peso molecular:604.75 g/mol4-Formyl-Benzamido-dPEG®12-TFP Ester
<p>4-Formyl-Benzamido-dPEG®12-TFP Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. 4-Formyl-Benzamido-dPEG®12-TFP Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Fórmula:C41H59F4NO16Pureza:Min. 95%Peso molecular:897.9 g/molSPDP-dPEG®36-Acid
CAS:<p>SPDP-dPEG®36-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. SPDP-dPEG®36-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Fórmula:C83H158N2O39S2Pureza:Min. 95%Peso molecular:1,872.26 g/molFmoc-Amido-dPEG®24-Amido-dPEG®24-Acid
<p>Fmoc-Amido-dPEG®24-Amido-dPEG®24-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Fmoc-Amido-dPEG®24-Amido-dPEG®24-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Fórmula:C117H214N2O53Pureza:Min. 95%Peso molecular:2,496.96 g/molDOTA-tris(Acid)-Amido-dPEG®3-Bromoacetamide
<p>DOTA-tris(Acid)-Amido-dPEG®3-Bromoacetamide is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. DOTA-tris(Acid)-Amido-dPEG®3-Bromoacetamide is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Pureza:Min. 95%Peso molecular:927.64 g/molGAP19 Trifluoroacetate
CAS:<p>Gap19 is a protein that regulates cell growth and has been implicated in cancer. Gap19 is a member of the myosin II family of proteins, which are involved in muscle contraction. Gap19 binds to calmodulin and is localized to the sarcomere region of cardiac ventricular myocytes. Gap19 has been shown to be a specific ligand for toll-like receptor 4 (TLR4). The binding of Gap19 leads to an increase in intracellular reactive oxygen species (ROS) levels, activation of transcription factors, and induction of inflammatory responses. These findings suggest that Gap19 plays an important role in regulating inflammatory diseases. Gap19 also has a biochemical function as a specific antibody for collagen, which is used to study cellular reactions involving collagen.</p>Fórmula:C55H96N14O13•(C2HF3O2)xPureza:Min. 95%Cor e Forma:PowderPeso molecular:1,161.45 g/molNHS-dPEG®4-( m-dPEG®8)3-Este
<p>NHS-dPEG®4-( m-dPEG®8)3-Este is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. NHS-dPEG®4-( m-dPEG®8)3-Este is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Fórmula:C182H347F4N5O86Pureza:Min. 95%Peso molecular:4,057.72 g/molm-dPEG®24-Amido-dPEG®24-DSPE
<p>m-dPEG®24-Amido-dPEG®24-DSPE is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. m-dPEG®24-Amido-dPEG®24-DSPE is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Fórmula:C142H281N2O58PPureza:Min. 95%Peso molecular:2,975.7 g/molMAL-dPEG®4-Glu(TFP e=Ester)-NH-m-dPEG®24
<p>MAL-dPEG®4-Glu(TFP Ester)-NH-m-dPEG®24 is a peptide containing polyethylene glycol (PEG) as spacer to alter their pharmacokinetic properties and pharmodynamics.</p>Fórmula:C78H134F4N4O35Pureza:Min. 95%Peso molecular:1,763.9 g/molAmino-dPEG®12-Tris (m-dPEG®24)3
<p>Amino-dPEG®12-Tris (m-dPEG®24)3 is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Amino-dPEG®12-Tris (m-dPEG®24)3 is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Fórmula:C187H373N5O91Pureza:Min. 95%Peso molecular:4,147.94 g/molCH3O-PEG-NH2
<p>CH3O-PEG-NH2 is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. CH3O-PEG-NH2 is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Pureza:Min. 95%Amino-dPEG®12-Tris (-dPEG®24-t-butyl Ester)3
<p>Amino-dPEG®12-Tris (-dPEG®24-t-butyl Ester)3 is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Amino-dPEG®12-Tris (-dPEG®24-t-butyl Ester)3 is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Pureza:Min. 95%Peso molecular:4,490.37 g/molCarboxyl-dPEG®4-(m-dPEG®12)3
CAS:<p>Carboxyl-dPEG®4-(m-dPEG®12)3 is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Carboxyl-dPEG®4-(m-dPEG®12)3 is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Pureza:Min. 95%Peso molecular:2,323.73 g/molFmoc-N-Lys-(dPEG®12-Biotin)-OH-(Acid)
CAS:<p>Please enquire for more information about Fmoc-N-Lys-(dPEG®12-Biotin)-OH-(Acid) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C12H22O8Pureza:Min. 95%Peso molecular:294.3 g/molm-dPEG®8-DSPE
<p>m-dPEG®8-DSPE is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. m-dPEG®8-DSPE is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Fórmula:C59H116NO17PPureza:Min. 95%Peso molecular:1,142.52 g/molH-Asp-Glu-OH
CAS:<p>H-Asp-Glu-OH is a molecule that may be a potential biomarker for prostate cancer cells. It was found to affect the brain functions, including the growth of brain cells and neurotransmitter release. H-Asp-Glu-OH has been shown to inhibit the growth of tumor cells in mice, but it is not as potent as other molecules in this class. This compound has also been shown to enhance hematopoietic cell proliferation and suppress the production of Th2 cytokines. Magnetic resonance spectroscopy studies have indicated that H-Asp-Glu-OH binds with low potency to GABA receptors in brain tissue, which may be associated with its ability to regulate neuronal excitability and inhibit epileptic seizures.</p>Fórmula:C9H14N2O7Pureza:Min. 95 Area-%Cor e Forma:White Off-White PowderPeso molecular:262.22 g/molBicalutamide-d4
CAS:Produto Controlado<p>Bicalutamide-d4 is a monocarboxylic acid that is a competitive inhibitor of androgens. It binds to the cytosolic receptor and blocks the action of dihydrotestosterone (DHT). Bicalutamide-d4 has been shown to be effective in reducing prostate cancer tumour growth, but not in treating prostate cancer. This drug is non-steroidal and acts as an antagonist of androgen receptors. Bicalutamide-d4 has been shown to induce the production of monocarboxylic acid metabolites such as sulfone and amide, which have anti-inflammatory effects on tissues.</p>Fórmula:C18H10D4F4N2O4SPureza:Min. 95%Peso molecular:434.4 g/molMAL-dPEG®2-TFP Ester
<p>MAL-dPEG®2-TFP Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. MAL-dPEG®2-TFP Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Fórmula:C81H149F4N3O38Pureza:Min. 95%Peso molecular:1,849.04 g/molt-boc-NH-dPEG®24-Tris (-TFP Ester)3
<p>t-boc-NH-dPEG®24-Tris (-TFP Ester)3 is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. t-boc-NH-dPEG®24-Tris (-TFP Ester)3 is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Fórmula:C87H132F12N2O36Pureza:Min. 95%Peso molecular:2,009.97 g/molDOTA-tris(Acid)-Amido-dPEG®23-Bromoacetamide
<p>DOTA-tris(Acid)-Amido-dPEG®23-Bromoacetamide is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. DOTA-tris(Acid)-Amido-dPEG®23-Bromoacetamide is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Pureza:Min. 95%Peso molecular:1,808.69 g/molDOTA-tris(TBE)-Amido-dPEG®12-TFP Ester
<p>DOTA-tris(TBE)-Amido-dPEG®12-TFP Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. DOTA-tris(TBE)-Amido-dPEG®12-TFP Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Pureza:Min. 95%Peso molecular:1,320.5 g/molm-dPEG®24-Propionaldehyde
<p>m-dPEG®24-Propionaldehyde is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. m-dPEG®24-Propionaldehyde is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Fórmula:C63H113N3O29S2Pureza:Min. 95%Peso molecular:1,440.7 g/molH-Ala-Pro-OH
CAS:<p>H-Ala-Pro-OH is a molecule that has the ability to bind to the active site of enzymes. It inhibits the activity of esterases and proteases by binding to their active sites and blocking access to substrates. This drug also inhibits the uptake of drugs in cells by competitively inhibiting membrane transport proteins, such as P-glycoprotein. H-Ala-Pro-OH binds to gamma-aminobutyric acid receptors and shows a kinetic effect on this neurotransmitter’s activity. The conformational properties of H-Ala-Pro-OH are not fully understood, but it is thought that its low energy allows it to bind to intracellular proteins more easily than other molecules.</p>Fórmula:C8H14N2O3Pureza:Min. 95%Cor e Forma:White Off-White PowderPeso molecular:186.21 g/molDOTA-tris(TBE)-Amido-dPEG®24-TFP Ester
<p>DOTA-tris(TBE)-Amido-dPEG®24-TFP Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. DOTA-tris(TBE)-Amido-dPEG®24-TFP Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Pureza:Min. 95%Peso molecular:1,320.5 g/molNSC16168
CAS:<p>NSC16168 is a molecule that has been shown to inhibit the influenza virus neuraminidase. It binds to the monoadducts of the viral neuraminidase and cisplatin, preventing them from binding to their cellular targets. This prevents viral replication and may also inhibit the dna methylation process in mammalian cells. NSC16168 can be used as a cancer therapy for cancer cells that express influenza virus neuraminidase on their surface.</p>Fórmula:C17H15NO9S3Pureza:Min. 95%Peso molecular:473.5 g/molAS 1892802
CAS:<p>AS 1892802 is a molecule that binds to the transcriptional regulator protein, C/EBPβ, and inhibits its ability to bind DNA. AS 1892802 has inhibitory effects on morphogenetic proteins (e.g., bone morphogenetic protein-2) and autoimmune diseases (e.g., diabetes). It also has an inhibitory effect on guanylate cyclase, which is an enzyme involved in the production of nitric oxide. AS 1892802 is also antinociceptive and anti-inflammatory in pain models. This compound also blocks angiotensin receptors as well as cyclase enzymes</p>Fórmula:C20H19N3O2Pureza:Min. 95%Peso molecular:333.38 g/molNHS-dPEG®4-( m-dPEG®12)3-Ester
CAS:<p>NHS-dPEG®4-( m-dPEG®12)3-Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. NHS-dPEG®4-( m-dPEG®12)3-Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Fórmula:C58H106N6O26Pureza:Min. 95%Peso molecular:1,303.49 g/molML390
CAS:<p>ML390 is a potent and selective inhibitor of the enzyme 3-phosphoglycerate dehydrogenase (3PGDH). This enzyme catalyzes the conversion of 3-phosphoglycerate to glyceraldehyde-3-phosphate, which is an important step in the synthesis of pyrimidine nucleotides. ML390 inhibits this enzyme with high selectivity and potency. It has been shown to be effective against glioblastoma cells, which may be due to its ability to inhibit their growth by targeting enzymes involved in pyrimidine biosynthesis.</p>Fórmula:C21H21F3N2O3Pureza:Min. 95%Peso molecular:406.4 g/molZ-Asn-Gly-OH
CAS:<p>Please enquire for more information about Z-Asn-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C14H17N3O6Pureza:Min. 95%Cor e Forma:PowderPeso molecular:323.3 g/molDOTA-tris(TBE)-Amido-dPEG®11-Maleimide
<p>DOTA-tris(TBE)-Amido-dPEG®11-Maleimide is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. DOTA-tris(TBE)-Amido-dPEG®11-Maleimide is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Pureza:Min. 95%Peso molecular:1,250.52 g/molBI-7273
CAS:<p>BI-7273 is a novel compound that is designed to treat wastewater. It has been shown to bind to mammalian cells and inhibit their growth, as well as prevent the formation of viscosity in wastewater. BI-7273 inhibits the activity of NADPH cytochrome P450 reductase (CPR) and prevents the formation of reactive oxygen species. It also binds to DNA polymerase, thereby inhibiting transcription and replication. The effects of BI-7273 on cancer cells have been investigated in vitro and in vivo. BI-7273 has also been shown to inhibit cell migration by interacting with specific proteins that are involved in cellular processes such as filament assembly.</p>Pureza:Min. 95%Thiocarbamyl nitro blue tetrazolium
CAS:<p>Thiocarbamyl nitro blue tetrazolium (TNT) is a stain that is used to identify the location of sarcoplasmic proteins in redox potentials. TNT is also used to identify the localization of proteins in isolated hearts, as well as during cancer research. The reaction products are phosphatase-based and can be detected visually. TNT can be used for functional assays that determine the mitochondrial activity of fatty acids and nitrosamines. TNT stains cellular organelles such as mitochondria, lysosomes, peroxisomes, and Golgi bodies.</p>Pureza:Min. 95%Peso molecular:935.82 g/molAzido-dPEG®12-TFP Ester
<p>Azido-dPEG®12-TFP Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Azido-dPEG®12-TFP Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Pureza:Min. 95%Peso molecular:791.78 g/molBiotin-dPEG®24-TFP Ester
<p>Biotin-dPEG®24-TFP Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Biotin-dPEG®24-TFP Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Fórmula:C67H117F4N3O28SPureza:Min. 95%Peso molecular:1,520.71 g/molMethoxytrityl-S-dPEG®4 Acid
CAS:<p>Methoxytrityl-S-dPEG®4 Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Methoxytrityl-S-dPEG®4 Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Pureza:Min. 95%Peso molecular:554.7 g/molMAL-dPEG®4-Lys(-5(6)-Carboxyfluorescein)-NH-m-dPEG®24
<p>MAL-dPEG®4-Lys(-5(6)-Carboxyfluorescein)-NH-m-dPEG®24 is a PEG compound containing a fluorescein dye used for tagging biomolecules, and serving as fluorescent probe for bioimaging applications.</p>Fórmula:C94H149N5O39Pureza:Min. 95%Peso molecular:1,973.2 g/molAmino-dPEG®4-(m-dPEG®12)3
CAS:<p>Amino-dPEG®4-(m-dPEG®12)3 is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Amino-dPEG®4-(m-dPEG®12)3 is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Fórmula:C56H107N5O26Pureza:Min. 95%Peso molecular:1,266.47 g/molNHS-m-dPEG®(MW = 1214)
CAS:<p>NHS-m-dPEG®(MW = 1214) is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. NHS-m-dPEG®(MW = 1214) is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Pureza:Min. 95%Peso molecular:1,214.39 g/molDBCO-dPEG®12-TFP Ester
<p>DBCO-dPEG®12-TFP Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. DBCO-dPEG®12-TFP Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Pureza:Min. 95%Peso molecular:1,067.12 g/molFmoc-N-Amido-dPEG®24-TFP Ester
<p>Fmoc-N-Amido-dPEG®24-TFP Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Fmoc-N-Amido-dPEG®24-TFP Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Fórmula:C72H113F4NO28Pureza:Min. 95%Peso molecular:1,516.67 g/molMAL-dPEG®36-TFP Ester
<p>MAL-dPEG®36-TFP Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. MAL-dPEG®36-TFP Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Fórmula:C25H35F4NO7S2Pureza:Min. 95%Peso molecular:601.67 g/molm-dPEG®24-Propionaldehyde
CAS:<p>m-dPEG®24-Propionaldehyde is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. m-dPEG®24-Propionaldehyde is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Fórmula:C50H100O25Pureza:Min. 95%Peso molecular:1,101.31 g/molFmoc-N-Amido-dPEG®8-TFP Ester
<p>Fmoc-N-Amido-dPEG®8-TFP Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Fmoc-N-Amido-dPEG®8-TFP Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Fórmula:C40H49F4NO12Pureza:Min. 95%Peso molecular:811.82 g/molt-boc-NH-dPEG®12-Tris(-TFP Ester)3
<p>t-boc-NH-dPEG®12-Tris(-TFP Ester)3 is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. t-boc-NH-dPEG®12-Tris(-TFP Ester)3 is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Fórmula:C63H84F12N2O24Pureza:Min. 95%Peso molecular:1,481.32 g/molCRANAD 2
CAS:<p>Please enquire for more information about CRANAD 2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C23H25BF2N2O2Pureza:Min. 95%Peso molecular:410.27 g/molMAL-dPEG®4-Glu(OH)-NH-m-dPEG®24
<p>MAL-dPEG®4-Glu(OH)-NH-m-dPEG®24 is a peptide containing polyethylene glycol (PEG) as spacer to alter their pharmacokinetic properties and pharmodynamics.</p>Fórmula:C72H134N4O35Pureza:Min. 95%Peso molecular:1,615.84 g/molNampt inhibitor-linker 1
CAS:<p>The protein Nampt inhibitor-linker 1 is a member of the NAMPT family. It is an enzyme that converts nicotinamide to nicotinamide mononucleotide in cells. Nampt inhibitor-linker 1 has been shown to be an activator of the receptor for amyloid precursor protein (APP) and may play a role in Alzheimer's disease. This protein is also involved in the regulation of ion channels, such as potassium channels, and ligand-gated ion channels, such as NMDA receptors.</p>Fórmula:C36H37FN6O6Pureza:Min. 95%Peso molecular:668.7 g/molBromoacetamido-dPEG®24-Amido-DBCO
<p>Bromoacetamido-dPEG®24-Amido-DBCO is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Bromoacetamido-dPEG®24-Amido-DBCO is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Pureza:Min. 95%Peso molecular:1,525.6 g/molLipoamido-dPEG®12-TFP Ester
CAS:<p>Lipoamido-dPEG®12-TFP Ester is a PEG molecule conjugated with a lipid moiety. Lipoamido-dPEG®12-TFP Ester, conjugated to this lipid constituent, is very important especially in drug delivery and vaccine development as it helps improve the stability and circulation time of lipid nanoparticles (LNPs) and liposomes.</p>Fórmula:C28H50N4O6S3Pureza:Min. 95%Peso molecular:634.91 g/molm-dPEG®48-NH-CO(CH2)3CO-TFP Ester
<p>m-dPEG®48-NH-CO(CH2)3CO-TFP Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. m-dPEG®48-NH-CO(CH2)3CO-TFP Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Fórmula:C108H203F4NO51Pureza:Min. 95%Peso molecular:2,407.76 g/molOrexin A trifluoroacetate
CAS:<p>Please enquire for more information about Orexin A trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C152H243N47O44S4•(C2HF3O2)xPureza:Min. 95%Nps-Val-OH·DCHA
CAS:Produto Controlado<p>Please enquire for more information about Nps-Val-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C11H14N2O4S·C12H23NPureza:Min. 95%Peso molecular:451.62 g/molMelittin trifluoroacetate
CAS:<p>Melittin is a peptide that is cationic and polycationic. It has been shown to be effective against mutants, such as those resistant to the antibiotic ampicillin. Melittin also has been shown to have a role in the development of vaccines for Brucella and typhimurium. The peptide has been shown to be effective against type species of these bacteria, such as Salmonella typhimurium and Brucella abortus. The mechanism of action of melittin is not fully understood but it may work by binding to the cell membrane, which causes ion leakage and consequently disrupts cellular functions.</p>Fórmula:C131H228N38O32Pureza:Min. 95%Cor e Forma:PowderPeso molecular:2,847.45 g/molTB 500 acetate
CAS:<p>Please enquire for more information about TB 500 acetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C38H68N10O14•(C2H4O2)xPureza:Min. 95%Cor e Forma:PowderHSV-gB2 (498-505) acetate
CAS:<p>Custom research peptide; min purity 95%.</p>Fórmula:C41H67N11O13•(C2H4O2)xPureza:Min. 95%Peso molecular:922.06 g/molWRW4
CAS:<p>Please enquire for more information about WRW4 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C61H65N15O6Pureza:Min. 95%Peso molecular:1,104.27 g/molH-GTSLSPPPESSGSPQQPGLSAPHSRQIPAPQGA VLVQREKDLPNYNWNSFGLRF-NH2
<p>Kisspeptin P</p>Fórmula:C257H393N75O78Pureza:Min. 95%GW 0742
CAS:<p>Peroxisome proliferator-activated receptor PPARβ/ÎŽ agonist</p>Fórmula:C21H17F4NO3S2Pureza:Min. 95%Peso molecular:471.49 g/molc26 Carnitine-d9
CAS:Produto Controlado<p>C26 Carnitine-d9 is a stable isotopically labeled form of carnitine, which is a quaternary ammonium compound naturally synthesized from amino acids lysine and methionine in the human body. Its isotopic labeling with deuterium enhances its application in various analytical techniques while retaining the biological properties of natural carnitine. The mode of action involves carnitine's essential role in the transport of long-chain fatty acids into the mitochondrial matrix for β-oxidation, facilitating energy production. C26 Carnitine-d9 is used primarily in metabolic research and diagnostics, particularly in studying fatty acid metabolism, assessing metabolic disorders, and quantifying carnitine levels in biological samples through techniques such as mass spectrometry. Its stable isotopic label allows for precise tracking and quantitation, offering insights into metabolic pathways and biochemical assays crucial for understanding metabolic functions and potential dysfunctions.</p>Fórmula:C33H56D9NO4Pureza:Min. 95%Peso molecular:548.93 g/molH-D-Ile-OBzl·p-tosylate
CAS:<p>H-D-Ile-OBzl·p-tosylate is a synthetic compound that has been found to have an excitatory effect on the bitter taste receptor. The leaves of plants are mutant and agglutination tests for this compound show that it is a hexapeptide. H-D-Ile-OBzl·p-tosylate can be synthesized from erythritol and p-toluenesulfonyl chloride. The chemical data for this compound indicates that it has a molecular weight of 442.3 Da and the observed spectra indicate that it is a white solid with no charge.</p>Fórmula:C13H19NO2·C7H8O3SPureza:Min. 95%Peso molecular:393.5 g/molCisatracurium besylate
CAS:<p>nAChRs nicotinic receptor antagonist; neuromuscular-blocking agent</p>Fórmula:C65H82N2O18S2Pureza:Min. 95%Cor e Forma:White PowderPeso molecular:1,243.48 g/molIsovaleryl-Phe-Lys-pNA·HCl
CAS:<p>Please enquire for more information about Isovaleryl-Phe-Lys-pNA·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C26H35N5O5·HClPureza:Min. 95%Peso molecular:534.05 g/molGAP 26 trifluoroacetate salt
CAS:<p>13-mer connexin mimetic peptide, composed of residue numbers 63-75 of the first extracellular loop of connexin 43 (gap junction blocker), containing the SHVR amino acid motif.</p>Fórmula:C70H107N19O19SPureza:Min. 95%Peso molecular:1,550.78 g/molPF-07104091
CAS:<p>PF-07104091 is a peptide that can activate the immune system by binding to an antibody. It is a research tool for use in cell biology, pharmacology, and immunology. PF-07104091 has been shown to inhibit the function of ion channels and receptors. This drug can also be used as a ligand in protein interactions and as an inhibitor of protein interactions.</p>Fórmula:C19H28N6O4Pureza:Min. 95%Peso molecular:404.5 g/molH-Glu(EDANS)-Pro-Leu-Phe-Ala-Glu-Arg-Lys(DABCYL)-OH
CAS:<p>Please enquire for more information about H-Glu(EDANS)-Pro-Leu-Phe-Ala-Glu-Arg-Lys(DABCYL)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C72H97N17O16SPureza:Min. 95%Peso molecular:1,488.71 g/molN-Acetyl-L-norleucyl-L-a-aspartyl-L-histidyl-3-(2-naphthalenyl)-D-alanyl-L-arginyl-L-tryptophyl-L-lysinamide-(2,7) -lactam
CAS:<p>Please enquire for more information about N-Acetyl-L-norleucyl-L-a-aspartyl-L-histidyl-3-(2-naphthalenyl)-D-alanyl-L-arginyl-L-tryptophyl-L-lysinamide-(2,7) -lactam including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C54H71N15O9Pureza:Min. 95%Peso molecular:1,074.24 g/molSuc-Leu-Leu-Val-Tyr-pNA
CAS:<p>Please enquire for more information about Suc-Leu-Leu-Val-Tyr-pNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C36H50N6O10Pureza:Min. 95%Peso molecular:726.82 g/molN-[(2RS,3RS)-2,3,4-Trihydroxy-butyl]-Val-Leu-anilide
CAS:<p>Please enquire for more information about N-[(2RS,3RS)-2,3,4-Trihydroxy-butyl]-Val-Leu-anilide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C21H35N3O5Pureza:Min. 95%Peso molecular:409.52 g/molEhrlichia Canis gp36 Antigen, Recombinant
<p>Please enquire for more information about Ehrlichia Canis gp36 Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Fmoc-Glu(OtBu)-Thr(psi(Me,Me)pro)-OH
CAS:<p>Fmoc-glu(otbu)-thr(psi(Me,Me)pro)-OH is a c1-6 alkoxy, expressed, alkenyl, linker, c1-6 alkyl, efficiency, sequence that can be used for peptide synthesis. It is an efficient linker for the synthesis of peptides and has been shown to yield high yields with few side products. The hydroxyl group on the side chain of the amino acid residue provides an additional site for acylation. This product also contains an aralkyl and alkoxy group that can be used in further reactions.</p>Fórmula:C31H38N2O8Pureza:Min. 95%Cor e Forma:PowderPeso molecular:566.64 g/molAmyloid β-Protein (35-25) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid beta-Protein (35-25) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C45H81N13O14SPureza:Min. 95%Cor e Forma:PowderPeso molecular:1,060.27 g/molSU086
CAS:<p>Chalcone compound that decreases HSP90 levels and inhibits prostate cancer cell growth and migration in vitro</p>Fórmula:C18H17NO6Peso molecular:343.33 g/molN-(2-Amino-ethyl)-2-(benzyl-phenyl-amino)-acetamide
CAS:<p>Please enquire for more information about N-(2-Amino-ethyl)-2-(benzyl-phenyl-amino)-acetamide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C17H21N3OPureza:Min. 95%Cor e Forma:White PowderPeso molecular:283.37 g/molEhrlichia Canis gp19 Antigen, Recombinant
<p>Please enquire for more information about Ehrlichia Canis gp19 Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Anaplasma Phagocytophilum Surface Protein AipA (Partial-length), Recombinant
<p>Please enquire for more information about Anaplasma Phagocytophilum Surface Protein AipA (Partial-length), Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Anaplasma Phagocytophilum Surface Protein AipA, Recombinant
<p>Please enquire for more information about Anaplasma Phagocytophilum Surface Protein AipA, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Fmoc-D-Ser(BSi)-OH
CAS:<p>Please enquire for more information about Fmoc-D-Ser(BSi)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C24H31NO5SiPureza:Min. 95%Peso molecular:441.59 g/molZ-N-Me-Ser(tBu)-OH·DCHA
CAS:<p>Please enquire for more information about Z-N-Me-Ser(tBu)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C16H23NO5·C12H23NPureza:Min. 95%Peso molecular:490.68 g/mol(Lys4)-Sarafotoxin C acetate salt
CAS:<p>A component of snake venom, this product contains disulfide bonds between Cys1 and Cys15/Cys3 and Cys11. <br>Due to their structural and functional homology to the endothelin peptides, Sarafotoxins can enhance vasoconstriction through stimulating the class A G-protein-coupled, endothelin ETA and ETB receptors. This in turn leads to left ventricular dysfunction and bronchoconstriction.</p>Fórmula:C105H153N27O36S5Pureza:Min. 95%Peso molecular:2,529.83 g/mol(S)-1-(3-(4-Amino-3-(4-phenoxyphenyl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)piperidin-1-yl)prop-2-en-1-one
CAS:<p>Please enquire for more information about (S)-1-(3-(4-Amino-3-(4-phenoxyphenyl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)piperidin-1-yl)prop-2-en-1-one including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C25H24N6O2Pureza:Min. 95%Peso molecular:440.5 g/molFlagellin 22 trifluoroacetate
CAS:<p>Please enquire for more information about Flagellin 22 trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C93H162N32O34•(C2HF3O2)4Pureza:Min. 95%Peso molecular:2,728.56 g/mol1,4-Diazabicyclo[2.2.2]octane bis(sulfur dioxide) adduct
CAS:<p>1,4-Diazabicyclo[2.2.2]octane bis(sulfur dioxide) adduct is a catalyst that can be used for the reduction of various functional groups. It is typically used to synthesize aziridines from amines and diazo compounds, or from halides and organometallic reagents. 1,4-Diazabicyclo[2.2.2]octane bis(sulfur dioxide) adduct has been shown to inhibit the production of sulfoxides by sulfide-reducing bacteria such as Desulfovibrio desulfuricans and Desulfobulbus propionicus.</p>Fórmula:C6H12N2O4S2Pureza:Min. 95%Peso molecular:240.3 g/molZ-Thr(Bzl)-OH·DCHA
CAS:Produto Controlado<p>Please enquire for more information about Z-Thr(Bzl)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C19H21NO5·C12H23NPureza:Min. 95%Peso molecular:524.69 g/molEhrlichia Canis gp19 Antigen, Recombinant
<p>Please enquire for more information about Ehrlichia Canis gp19 Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%H-D-Ile-Asp-OH
CAS:<p>Please enquire for more information about H-D-Ile-Asp-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C10H18N2O5Pureza:Min. 95%Peso molecular:246.26 g/molKT-474
CAS:<p>KT-474 is an oral small molecule protein degrader, which is derived from targeted protein degradation technology. This compound functions as an investigational agent specifically designed to degrade IRAK4, a key kinase involved in the signaling pathways of pro-inflammatory cytokines such as IL-1 and IL-18, which are crucial in the regulation of innate and adaptive immunity. The mode of action is based on hijacking the cell's ubiquitin-proteasome system to selectively bind to and degrade IRAK4, thereby reducing inflammation at the molecular level.</p>Fórmula:C44H49F2N11O6Pureza:Min. 95%Peso molecular:865.93 g/molDABCYL-Lys-HCoV-SARS Replicase Polyprotein 1ab (3235-3246)-Glu-EDANS trifluoroacetate salt
CAS:<p>DABCYL-Lys-HCoV-SARS Replicase Polyprotein 1ab (3235-3246)-Glu-EDANS trifluoroacetate salt is a fluorescent substrate for the SARS coronavirus. This compound is an inhibitor of the enzyme that is the target of a drug candidate that inhibits the replication of this virus. Molecular docking studies have shown that DABCYL-Lys-HCoV-SARS Replicase Polyprotein 1ab (3235-3246)-Glu-EDANS trifluoroacetate salt binds to 3clpro, which is part of the active site of the enzyme’s catalytic pocket. Inhibition activity was seen in experiments using recombinant proteins, and kinetic analysis showed this inhibitor has a Ki value of 0.7 mM.</p>Fórmula:C95H141N25O24S2·C2HF3O2Pureza:Min. 95 Area-%Cor e Forma:PowderPeso molecular:2,195.47 g/molZ-Ala-Ser-OH
CAS:<p>Z-Ala-Ser-OH is a basic protein with a sequence of Z-Ala-Ser. It has a hydrophobic section and carboxylic acid group, which is why it is soluble in organic solvents. The dichroic spectra of this protein are characteristic for its secondary structure. This protein can be analyzed using the technique of dichroism, which allows one to determine its analogs as well as analyze its enzyme preparations. The amino acid residues found in this protein are Ala and Ser, which are basic and polar respectively.</p>Fórmula:C14H18N2O6Pureza:Min. 95%Cor e Forma:PowderPeso molecular:310.3 g/molProcollagen Type I (212-216) H-Lys-Thr-Thr-Lys-Ser-OH
CAS:<p>Procollagen type I (212-216) H-Lys-Thr-Thr-Lys-Ser-OH is a tetrapeptide that is the most abundant component of human skin. It has been shown to have biological properties and can be synthesized in vitro. Procollagen type I (212-216) H-Lys-Thr-Thr-Lys-Ser-OH has an absorption maximum at 265 nm, which makes it suitable for use in uv protection creams. It also has a high chemical stability and can be stored for up to two years without degradation. Procollagen type I (212-216) H-Lys-Thr-Thr-Lys-Ser-OH is used as a substrate in cell culture to study protein synthesis and transcription, or polymerase chain reaction, technique. This peptide also inhibits the activity of proteases such as trypsin and chymotrypsin, making</p>Fórmula:C23H45N7O9Pureza:Min. 95%Cor e Forma:White Off-White PowderPeso molecular:563.65 g/molH-Pro-Thr-Glu-Phe-p-nitro-Phe-Arg-Leu-OH
CAS:<p>H-Pro-Thr-Glu-Phe-p-nitro-Phe-Arg-Leu-OH is a proteolytic inhibitor that inhibits the aspartic and hydrolytic enzymes. It has been shown to inhibit the activity of trypsin, pepsin, and elastase in human serum. This inhibitor also inactivates fibronectin by proteolysis. H-Pro-Thr-Glu-Phe-p-nitro-Phe-Arg-Leu OH has been shown to be specific for acidic proteases such as pepsin. The natural inhibitors of this peptide are Pro, Thr, Glu, Phe, Arg and Leu.</p>Fórmula:C44H63N11O13Pureza:Min. 95%Cor e Forma:PowderPeso molecular:954.04 g/mola2b1Integrin Recognition Sequence
CAS:<p>a2b1Integrin Recognition Sequence is a chemotherapeutic drug that is used in experimental models of hyperproliferative diseases, such as cancer. It activates α subunit of integrins, which are expressed on cells and mediate the adhesion to extracellular matrix proteins. The drug binds to integrin receptors on the surface of tubule cells and promotes their death by apoptosis. This protein stabilizes hydrogen bonding interactions between two or more molecules that are present at a site of chemical reaction, thus inhibiting cellular proliferation and tumor growth. As a result, a2b1Integrin Recognition Sequence inhibits the proliferation of human serum albumin (HSA) and basic fibroblast growth factor (bFGF), which are cell culture models for α subunit-integrin receptor interactions. Analysis of the structure of this protein reveals an integrin recognition sequence motif with three invariant residues: Arg-Gly-Asp (RGD).</p>Fórmula:C14H22N4O9Pureza:Min. 95%Peso molecular:390.35 g/molCathelicidin LL 37
CAS:<p>LL-37 is a potent antimicrobial peptide that has been shown to be effective against cancer cells and is currently being investigated as a potential antineoplastic agent. LL-37 binds to the leukocyte receptor, which leads to chemotaxis, increased expression of p53 and apoptosis. LL-37 also induces apoptotic cell death in epithelial tissues, both in vitro and in vivo. This peptide has been shown to induce death in cancer cells, as well as cell death in other types of cells.</p>Fórmula:C205H340N60O53Pureza:Min. 95%Peso molecular:4,493.27 g/molHuman ACTH(18-39) trifluoroacetate
CAS:<p>Please enquire for more information about Human ACTH(18-39) trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C112H165N27O36•(C2HF3O2)x8S-Cabergoline
CAS:<p>Please enquire for more information about 8S-Cabergoline including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C26H37N5O2Pureza:Min. 95%Peso molecular:451.6 g/molRetatrutide acetate
CAS:<p>Acetate salt; GLP-1, GIP, and GCGR2 mimic; Obesity research</p>Fórmula:C221H342N46O68•(C2H4O2)xPeso molecular:4,791.38 g/molLeishmania Infantum K39-LinJ Chimeric Antigen, Recombinant
<p>Please enquire for more information about Leishmania Infantum K39-LinJ Chimeric Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Entacapone
CAS:Produto Controlado<p>Catechol-O-methyltransferase inhibitor</p>Fórmula:C14H15N3O5Pureza:Min. 98 Area-%Cor e Forma:Yellow PowderPeso molecular:305.29 g/molCalmodulin-Dependent Protein Kinase II (290-309)
CAS:<p>Calmodulin-dependent protein kinase II (CAMKII) is a calcium/calmodulin-dependent enzyme that plays an important role in the regulation of cardiac contractility. CAMKII is activated by the binding of beta-adrenergic and other hormones to their receptors on the plasma membrane, leading to a change in the membrane potential. CAMKII then phosphorylates myofibrils, which leads to an increase in cardiac contractility. In liver cells, CAMKII activation leads to an increase in contractility and perfusion through increased ethylene production.</p>Fórmula:C103H185N31O24SPureza:Min. 95%Peso molecular:2,273.83 g/molGhrelin-[Cys(AF647)] Human
<p>Ghrelin is a peptide hormone mainly produced in the stomach. Ghrelin is involved in several physiological processes, including feeding, lipid accumulation, stress response- anxiety- cardiac performance- immunity and inflammation, taste sensation, reward-seeking behaviour, glucose metabolism and thermogenesis, memory, motivation and learning.Ghrelin exerts its actions by binding the growth hormone secretagogue receptor (GHSR), mainly found in the hypothalamic and mesolimbic brain regions and peripheral organs (adipose tissue, adrenals, and stomach).Ghrelin is produced by the cleavage of the precursor peptide preproghrelin. The attachment of a fatty acid to its serine 3 residue makes a form capable of activating GHSR.Ghrelin is a valuable target for treating conditions such as anorexia, cachexia, sarcopenia, cardiopathy, neurodegenerative disorders, renal and pulmonary disease, gastrointestinal disorders, inflammatory disorders and metabolic syndrome.This ghrelin has a C-terminal AF647, a structural analog to Alexa Fluor 647, a widely used far-red fluorescent dye. Its excitation is ideally suited to 594nm or 633nm. This dye is suited for low abundance targets as it has high initial brightness and a high photostability allowing detection of low abundance peptides.</p>Pureza:Min. 95%Peso molecular:4,326.9 g/molβ-Lactoglobulin B, from bovine milk
CAS:<p>Beta-Lactoglobulin B is the major whey protein in cow and sheep milk. Also the main component of milk skin, coagulating and denaturing when the milk boils.</p>Pureza:≥90% By Page.Cor e Forma:PowderN-Hippuryl-His-Leu trifluroacetate hydrate
CAS:<p>Hippuryl-His-Leu trifluroacetate hydrate can be used as an artificial substrate for angiotensin-converting enzyme (ACE).</p>Fórmula:C21H27N5O5(C2F3O2)x(H2O)xPureza:Min. 95%Peso molecular:429.47 g/mol9-cis-Retinoic acid
CAS:Produto Controlado<p>A natural metabolite of vitamin A. It is derived from all-trans retinoic acid, FR17921. It potently activates all isoforms of retinoic acid receptor (RAR) as well as retinoid X receptor (RXR) isoforms.</p>Fórmula:C20H28O2Pureza:Min. 95%Cor e Forma:PowderPeso molecular:300.44 g/molAngiotensin I/II (1-6)
CAS:<p>Angiotensin I/II 1-6 is a peptide containing amino acids 1-6; derived from from Angiotensin I/II.</p>Fórmula:C36H55N11O10Pureza:Min. 95%Peso molecular:801.89 g/molRubella BR2S Antigen
<p>Please enquire for more information about Rubella BR2S Antigen including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Pig RBC antibody
<p>Pig RBC antibody was raised in rabbit using porcine erythrocytes as the immunogen.</p>Pureza:Min. 95%Amyloid β-Protein (25-35) trifluoroacetate salt
CAS:<p>Amyloid beta-protein (Aβ) is a protein that is a major component of amyloid plaques in the brains of people with Alzheimer's disease. Aβ-Protein (25-35) trifluoroacetate salt, also known as Aβ(25-35), is an amyloid beta protein fragment that has been shown to inhibit neuronal death and increase antioxidative properties in human serum. It has been shown to have anti-apoptotic effects by inhibiting the activation of caspases and the release of cytochrome C from mitochondria. This drug may have physiological effects on the central nervous system due to its ability to induce apoptosis through mitochondrial membrane depolarization and cytosolic calcium levels. It has been shown to be active against Chinese herb Pueraria lobata and cell lysis, as well as granule neurons in culture. It may also stimulate phosphorylation of p38mapk and induce logarithmic growth</p>Fórmula:C45H81N13O14SPureza:Min. 95%Cor e Forma:PowderPeso molecular:1,060.27 g/molRecombinant Zika Virus NS1 Antigen
<p>Please enquire for more information about Recombinant Zika Virus NS1 Antigen including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Brucella Abortus Antigen
<p>Please enquire for more information about Brucella Abortus Antigen including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>FMRF-related peptide, Lymnaea heptapeptide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C41H59N11O9Peso molecular:850.00 g/molInfluenza NP (50-57)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C41H65N11O15Peso molecular:952.04 g/molH-Ile-Trp-OH
CAS:<p>H-Ile-Trp-OH is an acetylcholine esterase inhibitor that has been shown to have potent inhibitory activity against lorazepam. It binds to the active site of the enzyme, preventing it from breaking down acetylcholine and other neurotransmitters in the brain. H-Ile-Trp-OH is also a potent inhibitor of stenotrophomonas maltophilia, which is a bacterium found in chronic bronchitis patients. The drug has been tested in clinical studies for use as an immunomodulatory agent but has not yet been approved for this purpose.</p>Fórmula:C17H23N3O3Pureza:Min. 95%Peso molecular:317.38 g/molBoc-Thr(Ala-Fmoc)-OH
CAS:<p>Please enquire for more information about Boc-Thr(Ala-Fmoc)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C27H32N2O8Pureza:Min. 95%Cor e Forma:PowderPeso molecular:512.55 g/molZ-D-Arg(Z)2-OH
CAS:<p>Please enquire for more information about Z-D-Arg(Z)2-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C30H32N4O8Pureza:Min. 95%Peso molecular:576.6 g/molAndrostenedione antibody
<p>The Androstenedione antibody is a highly specialized antibody that targets and binds to androstenedione, a hormone involved in the production of testosterone and estrogen. This antibody has been extensively studied for its role in various research areas, including hormone regulation, reproductive health, and cancer studies.</p>Pureza:Min. 95%H-Leu-NHOH·TFA
CAS:<p>H-Leu-NHOH·TFA is a histidine analogue that is used as a catalyst. It has been shown to be an effective inhibitor of corynebacteria, and can be used in the synthesis of fatty acids, which are important for cell membrane production. H-Leu-NHOH·TFA also binds to the enzyme synthetase and inhibits its activity, which blocks the conversion of ammonia and amino acids into polypeptides. This inhibition prevents bacterial growth. H-Leu-NHOH·TFA is active at acidic pH levels, with a maximum activity at pH 4.0. The optimum temperature for this compound is 50°C, but it will still work at temperatures up to 60°C.</p>Fórmula:C6H14N2O2·C2HF3O2Pureza:Min. 95%Cor e Forma:PowderPeso molecular:260.21 g/molH-D-Arg(Mtr)-OH
CAS:<p>H-D-Arg(Mtr)-OH is a biochemical that is used for the deprotection of prohormones. H-D-Arg(Mtr)-OH has been shown to have an interaction with peptidyl residues, which modulates their activity. H-D-Arg(Mtr)-OH also modulates the allosteric activity of fibrinogen and thrombin receptor. The use of this chemical in solid phase synthesis provides a way to synthesize peptides on a solid support, such as indole rings, amino acids, or nucleotides. The chemical can be used in the hplc system to determine the concentration of small molecules in solution by measuring the peak area.</p>Fórmula:C16H26N4O5SPureza:Min. 95%Peso molecular:386.47 g/molIsosulfan blue
CAS:<p>Isosulfan blue is a dye that has been used for decades to detect skin cancer in vivo. It is a synthetic compound that binds to the lymphatic system and can be used as an analytical method for detecting cancer. Isosulfan blue is excreted through the urine and can be detected by plasma mass spectrometry, making it a useful tool for assessing toxicity levels in humans. The chemical structure of Isosulfan blue is similar to many other dyes, which makes it difficult to study its toxicity in vivo.</p>Fórmula:C27H31N2NaO6S2Pureza:Min. 95%Peso molecular:566.67 g/molβ-Casomorphin (1-5) (bovine) trifluoroacetate
CAS:<p>Please enquire for more information about β-Casomorphin (1-5) (bovine) trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C30H37N5O7•C2HF3O2Pureza:Min. 95%Peso molecular:693.67 g/molCys-Gly-Lys-Lys-Gly-Amyloid β-Protein (33-40)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C51H92N15O14S2Peso molecular:1,203.52 g/molCorazonin, American Cockroach, Periplaneta americana
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C62H86N18O19Peso molecular:1,369.49 g/molBradykinin Potentiator B
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C56H91N15O13Peso molecular:1,182.46 g/molCaspase 2 Substrate, chromogenic
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C31H43N9O14Peso molecular:765.7 g/molBiotin-MBP(94-102)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C49H84N20O13SPeso molecular:1,193.41 g/molAquaporin-2 (255-271), human
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C77H129N25O26Peso molecular:1,821.04 g/molAngiotensin II Substrate
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C50H72N13O15PPeso molecular:1,126.20 g/molHemagglutinin (48-68) / Influenza virus
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C97H163N29O32S2Peso molecular:2,311.67 g/molAtrial Natriuretic Peptide (4-24), frog
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C93H152N34O27S3Peso molecular:2,273.64 g/molAquaporin-2 (255-271), rat
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C78H131N25O26Peso molecular:1,835.07 g/molµ-Conotoxin GIIIA
CAS:Produto Controlado<p>Conotoxins are peptides that can bind to specific receptors on the surface of cells. Their function is to regulate ion channels and thus affect cellular physiology. Conotoxin GIIIA is a disulfide-bonded peptide with a molecular weight of 5808 Da. It has been shown to inhibit Na+ channel activity in human serum, and may have diagnostic and therapeutic applications for diseases such as epilepsy. The amino acid sequence of conotoxin GIIIA is Arg-Asp-Cys-Cys-Thr-Hyp-Hyp-Lys-Lys-Cys-Lys-Asp-Arg-Gln-Cys (NH2)</p>Fórmula:C100H170N38O32S6Pureza:Min. 95%Peso molecular:2,609.05 g/mol(Deamino-Phe19,D-Ala24,D-Pro26-psi(CH2NH)Phe27)-GRP (19-27) (human, porcine, canine) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Deamino-Phe19,D-Ala24,D-Pro26-psi(CH2NH)Phe27)-GRP (19-27) (human, porcine, canine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C57H72N14O8Pureza:Min. 95%Peso molecular:1,081.27 g/molZ-Ile-Leu-aldehyde
CAS:<p>Please enquire for more information about Z-Ile-Leu-aldehyde including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C20H30N2O4Pureza:Min. 95%Peso molecular:362.46 g/molSartorypyrone D
CAS:<p>Sartorypyrone is active against the Gram-positive bacteria B. subtilis, K. rhizophila, and M. smegmatis</p>Fórmula:C26H38O4Pureza:Min. 95%Peso molecular:414.6 g/molMethyltetrazine magnetic beads
<p>Methyltetrazine magnetic beads are uniform polymer-based magnetic spheres of 1 µm diameter. A unique surface means low nonspecific binding in protein-based systems, and superior handling without the use of surfactant. These high-binding beads are suitable for use across a range of research and diagnostic applications, whether you’re working at laboratory scale or have the more stringent requirements of high throughput applications.<br>Activation level: 20-35 nmol methyltetrazine groups per mg<br>Bead diameter: 0.8-1 µmThe magnetic beads are not stable in organic solvents. Work in aq. solutions at a pH range of 4-9.</p>Pureza:Min. 95%Cor e Forma:Clear LiquidH-Ile-Pro-OH
CAS:<p>H-Ile-Pro-OH is an amino acid that is a constituent of sphingolipids, which are important for the metabolism of lipids and other biological substances. H-Ile-Pro-OH can be found in casein as well as oxidation products of casein. It has been used in diagnostic tests to measure levels of hippuric acid in plasma samples. The dietary intake of H-Ile-Pro-OH can be determined by measuring the concentration of this amino acid in plasma samples. Synthetic H-Ile-Pro-OH can also be used for studies on the metabolism of tryptophan. This amino acid has been shown to inhibit chloride ion transport across the cell membrane and fatty acid synthesis, as well as proteolysis and protein degradation by pancreatic enzymes.</p>Fórmula:C11H20N2O3Pureza:Min. 95%Peso molecular:228.29 g/molZ-Ile-Pro-OH
CAS:<p>Z-Ile-Pro-OH is an experimental inhibitor of protein synthesis that has been shown to inhibit collagenase and pancreatic proteases. Z-Ile-Pro-OH inhibits the second order rate constant of hydrolysis by a kinetic method. The pH optimum of Z-Ile-Pro-OH is 7.5 and it does not hydrolyze at this pH. Z-Ile-Pro-OH binds to the active site of the protease, inhibiting its activity and has been shown to be non toxic in mice. The synthetic inhibitor has been used as a nutritional supplement for humans because it does not affect the pancreas or liver when ingested orally, but has no effect on bone growth.</p>Fórmula:C19H26N2O5Pureza:Min. 95%Peso molecular:362.42 g/molFmoc-Ser(tBu)-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-Ser(tBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%H-Ile-Ala-OH
CAS:<p>H-Ile-Ala-OH is a high quality product that has been extensively validated for its stability and effectiveness. It is a zymogen that has been shown to be active against pancreatic enzymes. H-Ile-Ala-OH binds to the hydrophobic region of the enzyme, which may be due to hydrogen bonding. The diameter of this molecule is 8.3 Ångströms, which allows it to bind to the enzyme's active site. H-Ile-Ala-OH has been shown to have prognostic value in cancer patients and can be used as a profile marker in porcine cells.</p>Fórmula:C9H18N2O3Pureza:Min. 95%Peso molecular:202.25 g/molH-Asp-Ala-OH
CAS:<p>Adriamycin is an anticancer drug that is a structural analogue of aspartic acid. It can be synthesized in a solid-phase synthesis using a polymeric resin with an acidic functional group, such as H-Asp-Ala-OH. Adriamycin inhibits the production of inflammatory cytokines and prostaglandins, which are involved in the development of inflammatory diseases. Adriamycin has been shown to have anti-inflammatory effects on human serum and to inhibit the production of proteins important for tumor cell proliferation. Adriamycin also has anti-inflammatory properties due to its ability to bind with hydrogen bonds to acidic residues on proteins.<br>END></p>Fórmula:C7H12N2O5Pureza:Min. 98 Area-%Cor e Forma:PowderPeso molecular:204.18 g/molH-Asp-NH2
CAS:<p>H-Asp-NH2 is an isomeric mixture of l-phenylalanine and its methyl ester. It is used as a feed additive in animals to improve growth and feed conversion efficiency. The deamination of H-Asp-NH2 produces hydrogen peroxide, which has been shown to be lethal to enterobacteriaceae. This compound may also act as a microbial growth inhibitor by preventing the formation of peptides during synthesis.</p>Fórmula:C4H8N2O3Pureza:Min. 95%Peso molecular:132.12 g/molBoc-Cys(SO3H)-OH·disodium salt
CAS:<p>Please enquire for more information about Boc-Cys(SO3H)-OH·disodium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C8H13NNa2O7S2Peso molecular:345.3 g/molH-Met-Met-OH
CAS:<p>H-Met-Met-OH is a dietary supplement that has been shown to have a variety of health benefits in animals. It has been shown to increase the production of tnf-α and other fatty acids, which are known to play a role in cellular physiology. H-Met-Met-OH also has the ability to inhibit protein synthesis and this is thought to be due to its transport properties as well as its reaction products. H-Met-Met-OH can be taken orally or given through explants, either orally or by injection.</p>Fórmula:C10H20N2O3S2Pureza:Min. 95%Cor e Forma:White PowderPeso molecular:280.41 g/molZ-Ile-Trp-OH
CAS:<p>Please enquire for more information about Z-Ile-Trp-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C25H29N3O5Pureza:Min. 95%Peso molecular:451.51 g/molH-Thr-Asp-OH TFA salt
CAS:<p>Please enquire for more information about H-Thr-Asp-OH TFA salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C8H14N2O6C2F3HO2Pureza:Min. 95%Peso molecular:348.23 g/molZ-Ile-Met-OH
CAS:<p>Z-Ile-Met-OH is a synthetic protease that has been used in the immobilization of κ-carrageenan. The endopeptidase activity of this protease was proved to be higher than that of trypsin and chymotrypsin. It can also be used as an immobilized enzyme for the hydrolysis of polyacrylamide.</p>Fórmula:C19H28N2O5SPureza:Min. 95%Peso molecular:396.5 g/molH-Ser-Ile-Lys-Val-Ala-Val-OH
CAS:<p>H-Ser-Ile-Lys-Val-Ala-Val-OH is a peptide that is synthesized from the amino acid sequence of the human skin cells. It has been shown to be effective in inhibiting bacterial growth and inducing death in bacteria. This peptide binds to the bacterial cell wall and inhibits its growth. The polymer film can be used for the delivery of H-Ser-Ile-Lys-Val-Ala-Val-OH in the form of lamellar, galacturonic acid, collagen, or lipid nanoparticles. The lamellar phase can be prepared by using water as solvent and lipids as surfactant. The lipid nanoparticle formulation consists of a core material (e.g., cholesterol) surrounded by a lipid bilayer composed of phospholipids or glycolipids with H Ser Ile Lys Val Ala Val OH incorporated into it. This peptide has also been shown to have skin care properties when</p>Fórmula:C28H53N7O8Pureza:Min. 95%Peso molecular:615.76 g/molBoc-D-Glu-OEt·DCHA
CAS:Produto Controlado<p>Please enquire for more information about Boc-D-Glu-OEt·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C12H21NO6·C12H23NPureza:Min. 95%Peso molecular:456.62 g/molH-Ile-His-OH
CAS:<p>H-Ile-His-OH is a peptide that has been found to be an antagonist of the epidermal growth factor receptor. It has been shown to decrease inflammation in animal models of bowel disease and may be useful in the treatment of inflammatory bowel disease. H-Ile-His-OH has also been shown to inhibit the production of inflammatory cytokines such as IL-1β, IL-6, and TNF α. This peptide also inhibits monoclonal antibody production by dendritic cells and can prevent resistant mutants from developing. H-Ile-His-OH is a potent antagonist of Toll-Like Receptor (TLR) 4, TLR2, TLR3, and TLR9. H-Ile-His-OH is currently being investigated for its possible role in the treatment of infectious diseases and autoimmune diseases.</p>Fórmula:C12H20N4O3Pureza:Min. 95%Peso molecular:268.31 g/molBCIP dipotassium
CAS:<p>BCIP (5-bromo-4-chloro-3-indolyl phosphate) dipotassium is a chromogenic substrate commonly used for the detection of the enzymatic activity of alkaline phosphatase. Upon dephosphorylation by alkaline phosphatase, BCIP produces a blue precipitate, which can be easily visualized. This substrate has various uses, including the detection of gene expression in molecular biology, the identification of alkaline phosphatase activity in clinical pathology, and the detection of protein-protein interactions in biochemistry. Its long-term stability in solution makes it a common choice for many applications.</p>Fórmula:C8H4BrClK2NO4PPureza:Min. 98 Area-%Cor e Forma:PowderPeso molecular:402.65 g/molBoc-D-His(Boc)-OH benzene solvate
CAS:<p>Please enquire for more information about Boc-D-His(Boc)-OH benzene solvate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C16H25N3O6Pureza:Min. 95%Cor e Forma:SolidPeso molecular:355.39 g/molAOD9604
CAS:<p>AOD9604 is a research tool that can be used as an activator, inhibitor, or ligand for receptors and ion channels. It is also known as a cell-permeable peptide with a molecular weight of 1203 Daltons. AOD9604 has been shown to bind to the receptor for nerve growth factor (NGF), which is a protein involved in neuronal development. It has also been shown to bind to the receptor for insulin-like growth factor 1 (IGF-1) and the receptor for epidermal growth factor (EGF).</p>Fórmula:C78H123N23O23S2Pureza:Min. 95%Peso molecular:1,815.1 g/molNps-Lys(Boc)-OH·DCHA
CAS:Produto Controlado<p>Please enquire for more information about Nps-Lys(Boc)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C17H25N3O6S·C12H23NPureza:Min. 95%Peso molecular:580.78 g/molBig Endothelin-1 (1-39), porcine
<p>Please enquire for more information about Big Endothelin-1 (1-39), porcine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Feline Herpes Virus 1 Antigen, recombinant
<p>Potentially suitable for lateral flow, ELISA and IFA applications</p>Pureza:Min. 95%Feline Calicivirus VP1 Antigen, recombinant
<p>Potentially suitable for lateral flow, ELISA and IFA applications</p>Pureza:Min. 95%Boc-Lys(Tfa)-AMC
CAS:<p>Boc-Lys(Tfa)-AMC is a small molecule that inhibits the acetylation of histone H3 and has anticancer activity. Acetylation increases the rate of transcription and replication, whereas Boc-Lys(Tfa)-AMC inhibits this process by preventing acetylation. This drug also binds to δ-opioid receptors in cancer cells, triggering a redox signal that leads to inhibition of cancer cell proliferation. The mechanism of this drug's anticancer activity is unknown, but it may be due to its ability to inhibit enzyme activities or disulfide bond formation in vivo.</p>Fórmula:C23H28F3N3O6Pureza:Min. 95%Peso molecular:499.48 g/molGRF (human) acetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Fórmula:C215H358N72O66SPureza:Min. 98 Area-%Cor e Forma:PowderPeso molecular:5,039.65 g/molFmoc-D-Asp(OtBu)-(Hmb)Gly-OH
CAS:<p>Please enquire for more information about Fmoc-D-Asp(OtBu)-(Hmb)Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C33H36N2O9Pureza:Min. 95%Peso molecular:604.65 g/molZ-D-Phe-Phe-Gly-OH
CAS:<p>Z-D-Phe-Phe-Gly-OH is a lysosomal carboxypeptidase that hydrolyzes peptides at the C terminus of proteins. It has a wide substrate specificity and can hydrolyze Z-D-Phe-Phe-Gly, Z-Arg-Lys, and L-Arg. This enzyme has been shown to have ion exchange chromatography activity. The elution profile for this enzyme on a sephadex G-100 column was found to have an optimum pH of 7.5 and elutes at a salt concentration of 0.5M NaCl. Carboxypeptidases are enzymes that cleave at the C terminus of proteins to produce smaller peptides or amino acids. They are involved in digestion, blood clotting, and cell signaling processes.</p>Fórmula:C28H29N3O6Pureza:Min. 95%Cor e Forma:White Off-White PowderPeso molecular:503.55 g/molH-Ile-NHOH acetate salt
CAS:<p>H-Ile-NHOH acetate salt is an inhibitor of l-amino acid metabolism. It is a competitive inhibitor of the enzyme L-amino acid oxidase, which catalyzes the conversion of l-amino acids to alpha-keto acids and ammonia. H-Ile-NHOH acetate salt has been shown to inhibit the growth of wild type C. glutamicum in a molecular modeling study. In addition, this compound has been shown to block messenger RNA (mRNA) synthesis in a mutant strain of C. glutamicum that does not have the frameshifting mutation. H-Ile-NHOH acetate salt is also known to be an inhibitor of fatty acid biosynthesis by blocking the activity of acyl carrier protein synthetase and acyl carrier protein reductase.</p>Fórmula:C6H14N2O2Pureza:Min. 95%Peso molecular:146.19 g/molPF-9363
CAS:<p>PF-9363 is a peptide that is a cell-permeable activator of the ion channel TRPM2 and is used for research purposes. It is also an inhibitor of protein interactions. PF-9363 has a molecular weight of 921.03 daltons and a CAS number of 2569009-58-9. This peptide can be used in the study of ion channels, ligands, and receptor pharmacology.</p>Fórmula:C20H20N4O6SPureza:Min. 95%Peso molecular:444.50 g/molH-D-Ala-Gln-octadecyl ester·HCl
CAS:<p>Please enquire for more information about H-D-Ala-Gln-octadecyl ester·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C26H51N3O4·HClPureza:Min. 95%Peso molecular:506.16 g/molFmoc-Gly-Cys(Psi(Dmp,H)pro)-OH
CAS:<p>Please enquire for more information about Fmoc-Gly-Cys(Psi(Dmp,H)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C29H28N2O7SPureza:Min. 95%Peso molecular:548.61 g/molω-Conotoxin MVIIC
CAS:Produto Controlado<p>Omega-Conotoxin MVIIC is a peptide toxin that blocks the voltage-dependent calcium channels. It has been shown to have neuroprotective properties and to inhibit glutamate induced neurotoxicity in vitro and in vivo. Omega-Conotoxin MVIIC inhibits neurotransmitter release by blocking the calcium channels and thereby reduces oxidative stress, which prevents neuronal cell death. This toxin also blocks the activity of voltage-dependent sodium channels, but its effects are not as potent as those on calcium channels. Omega-Conotoxin MVIIC has been found to be effective against cerebellar granule neurons, as well as other neurons in the brainstem, cerebellum, hippocampus, and cerebral cortex. The molecular weight of this toxin is approximately 10 kDa and it contains subunits (a total of eight).</p>Fórmula:C106H178N40O32S7Pureza:Min. 95%Cor e Forma:PowderPeso molecular:2,749.26 g/molFmoc-Lys(Nde)-OH
CAS:<p>Please enquire for more information about Fmoc-Lys(Nde)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C32H29N3O8Pureza:Min. 95%Peso molecular:583.59 g/molH-Ile-Ile-Ile-OH acetate salt
CAS:<p>Please enquire for more information about H-Ile-Ile-Ile-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C18H35N3O4Pureza:Min. 95%Peso molecular:357.49 g/molZ-Gly-Val-OH
CAS:<p>Z-Gly-Val-OH is an inhibitor that can be used for the synthesis of peptides. It is a c-terminal amino acid with an optically active, cyclic structure. Z-Gly-Val-OH can be coupled to azide and spheric amino acids, and it undergoes racemization in solvents containing additives. This reagent can also be used for the synthesis of peptides with epimerization or chlorine.</p>Fórmula:C15H20N2O5Pureza:Min. 95%Cor e Forma:PowderPeso molecular:308.33 g/molH-Trp-Trp-OH
CAS:<p>H-Trp-Trp-OH is a reaction product of the amino acid tryptophan and various electron donors. The radical form of H-Trp-Trp-OH has been studied using 2D nuclear magnetic resonance (NMR) spectroscopy to determine its structure. In addition, H-Trp-Trp-OH has been used to study the mechanism of protein phosphorylation reactions. This chemical can be prepared from a solution of tryptophan in water and an oxidizing agent such as hydrogen peroxide or sodium hypochlorite. The frequency shift observed for H-Trp-Trp-OH was attributed to the presence of a constant that was found to be 10 Hz/M, indicating that this substance is a radical form. The sample preparation technique used in this experiment consisted of adding an equal volume of acetic acid to an unknown sample and then centrifuging it at 5000 rpm for five minutes before measuring its fluorescence emission.</p>Fórmula:C22H22N4O3Pureza:Min. 95%Peso molecular:390.44 g/molFmoc-Lys(Boc)-Wang resin (200-400 mesh)
CAS:<p>Please enquire for more information about Fmoc-Lys(Boc)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Boc-ε-azido-Nle-OH·DCHA
CAS:Produto Controlado<p>Please enquire for more information about Boc-epsilon-azido-Nle-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C11H20N4O4·C12H23NPureza:Min. 95%Peso molecular:453.62 g/molIsovaleryl-Val-Val-Sta-OEt
CAS:<p>Isovaleryl-Val-Val-Sta-OEt is a peptide hormone and active inhibitor of the enzyme pepsin. This drug has been shown to have proteolytic activity in vitro, with a pepsin rate constant of 0.0015 min−1. It also inhibits the protease activity of trypsin, chymotrypsin, and elastase at a similar rate. Isovaleryl-Val-Val-Sta-OEt has been shown to be an active inhibitor of polymerase chain reaction (PCR) and reverse transcriptase activities. This drug is not absorbed through skin and can be used as a nonimmunogenic reagent for biochemical studies on water permeability and signal peptide sequences in biological samples.</p>Fórmula:C25H47N3O6Pureza:Min. 95%Peso molecular:485.66 g/molPmc-S-methylisothiourea
CAS:<p>Pmc-S-methylisothiourea is a synthetic compound that is used as a cross-coupling agent in organic synthesis. It has been shown to be an efficient and selective catalyst for Suzuki reactions. Pmc-S-methylisothiourea can be used to synthesize isoforms of macrolides, which are compounds with a skeleton similar to penicillin. Pmc-S-methylisothiourea can also be modified by adding ligands, such as thyronine, which can bind to hormone receptors and regulate transcription.</p>Fórmula:C16H24N2O3S2Pureza:Min. 95%Cor e Forma:PowderPeso molecular:356.51 g/molGlutaryl-Phe-bNA
CAS:<p>Please enquire for more information about Glutaryl-Phe-bNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C24H24N2O4Pureza:Min. 99 Area-%Peso molecular:404.46 g/molZ-Ile-Glu(OtBu)-Ala-Leu-aldehyde
CAS:<p>Z-Ile-Glu(OtBu)-Ala-Leu-aldehyde, also known as ZILEAL, is a potent immunosuppressant that binds to the Toll-like receptor (TLR) and inhibits NF-κB binding activity. It has been shown to reduce the activation of macrophages by inhibiting the production of proinflammatory cytokines such as tumor necrosis factor alpha (TNFα), IL-1β, and IL-6. This drug has been shown to inhibit HIV replication in vitro and was also found to have an antiviral effect against herpes simplex virus type 1 in vivo. ZILEAL also inhibits dsDNA binding activity, which may have potential applications in cancer treatment.</p>Fórmula:C32H50N4O8Pureza:Min. 95%Peso molecular:618.76 g/molZ-Ile-Val-OH
CAS:<p>Please enquire for more information about Z-Ile-Val-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C19H28N2O5Pureza:Min. 95%Peso molecular:364.44 g/molAc-Ser-Asp-Lys-Pro-OH
CAS:<p>Ac-Ser-Asp-Lys-Pro-OH is a tetrapeptide that has been shown to stimulate the growth of cells in vitro. It has been found to inhibit the production of interleukin-1β and tumor necrosis factor α, which are cytokines that are involved in inflammation. Ac-Ser-Asp-Lys-Pro-OH stimulates the production of growth factor β1 and collagen, which may be due to its ability to bind to toll like receptor 4 (TLR4). Acetylserotonin has been shown to have antiinflammatory and antifibrotic properties in animal models. Acetylserotonin also inhibits cancer cell growth and reduces drug resistance.</p>Fórmula:C20H33N5O9Pureza:Min. 95%Peso molecular:487.5 g/molTyrosinase (243-251) (human) acetate salt
CAS:<p>H-KCDICTDEY-OH peptide, corresponding to amino acids 243-251 of human Tyrosinase. The peptide is supplied as an acetate salt.</p>Fórmula:C44H68N10O18S2Pureza:Min. 95%Peso molecular:1,089.2 g/molTyrosinase (206-214) (human) acetate salt
CAS:<p>H-AFLPWHRLF-OH peptide, corresponding to amino acids 206-214 of human Tyrosinase. The peptide is supplied as an acetate salt.</p>Fórmula:C61H83N15O10Pureza:Min. 95%Peso molecular:1,186.41 g/molAllatostatin VI
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C65H90N18O16Peso molecular:1,379.5 g/molTyrosinase (192-200) (human, mouse) acetate salt
CAS:<p>H-SEIWRDIDF-OH peptide, corresponding to amino acids 192-200 of human and mouse Tyrosinase. The peptide is supplied as an acetate salt.</p>Fórmula:C54H77N13O17Peso molecular:1,180.27 g/molMyosin Light Chain Kinase (480-501)
CAS:<p>H-AKKLSKDRMKKYMARRKWQKTG-NH2 peptide, corresponding to 480-501 amnino acids of Myosin Light Chain Kinase. Myosin Light Chain Kinase is a serine/threonine specific protein kinase that phosphorylates the myosin light chain.</p>Fórmula:C120H209N41O28S2Pureza:Min. 95%Peso molecular:2,738.34 g/mol(Val438)-Tyrosinase (432-444) (human) acetate salt
CAS:<p>H-SYLQDSVPDSFQD-OH peptide, corresponding to amino acids 432-444 of human Tyrosinase. The peptide is supplied as an acetate salt.</p>Fórmula:C65H93N15O26Pureza:Min. 95%Peso molecular:1,500.52 g/mol
