Bioquímicos e reagentes

<p>EasyGenotyping PCR-RFLP S. aureus</p>

<p>EasyPCR HIV</p>

<p>Betulin</p>

<p>2xPCR TaqNovaHS</p>

<p>Tetracycline hydrochloride (10mg/ml)</p>

<p>DNaseMe</p>

<p>Murashige and Skoog modified basal salts (? micros and ? macros)</p>

<p>M50pz DNA Ladder</p>

<p>M100-500 DNA Ladder ready-to-use</p>

<p>Calyculin A</p>

<p>Nonfat dried milk powder</p>

<p>Serazym® Bovine Serum Albumin 96 well plate</p>

<p>TaqNova DNA Polymerase</p>

<p>Stability Light Sensitive<br>Applications 6,7-Dimethyl-8-ribityllumazine serves as fluorophore in Lumazine (L473800) proteins (LumP) of luminescent bacteria.<br>References Kulinski, T., et al.: Biochemistry, 26, 540 (1987), Chatwell, L., et al.: J. Mol. Biol., 382, 44 (2008), Sancar, A., et al.: J. Biol. Chem., 283, 32153 (2008),<br></p>

<p>Stability Hygroscopic<br>Applications A nucleoside used in the synthesis of ribothymidine-3'-phosphate.<br></p>

<p>Applications Monocaprylin is used in preparation of Citric Acid mixed grease plasticizer.Also, It is an active agent for skin and hair care with pysicochemistry modifying properties.<br>References Wang, M., et al.: Faming Zhuanli Shenqing, (2020); Kohlen, R., et al.: PCT Int. Appl., (2020);<br></p>

<p>Applications Convallatoxin is a cardenolide that is used in the treatment of congestive heart failure. It may also be used in the treatment of tumor cells at nanomolar concentrations due to its anti-proliferative effects; in particular, human lung cancer. It is naturally found in the roots of Adonis Amurensis.<br> Not a dangerous good if item is equal to or less than 1g/ml and there is less than 100g/ml in the package<br>References Schneider, N., et al.: Nat. Prod. Res., (2015); Yin, L., et al.: Zhong Cao Yao, 45, 3361 (2014);<br></p>

<p>Applications 1,3-Distearoyl-2-oleoyl Glycerol is a triacid triglyceride found in cocoa butter and is used in the improvement of chocolate.<br>References Padley, F.B. et al.: Rev. Int. Choc., 27, 278 (1972);<br></p>

<p>Applications L-Citrulline-d7, is the labeled analogue of L-Citrulline (C535700), which is an amino acid, first isolated from the juice of watermelon, Citrullus vulgaris Schrad., Cucurbitaceae. It is also used in the treatment of asthenia.<br>References Kurtz, et al.: J. Biol. Chem., 122, 477 (1938), Rajantie, J., et al.: J. Pediatr., 97, 927 (1980), Carpenter, T.O., et al.: N. Engl. J. Med., 312, 290 (1985),<br></p>

<p>Applications Verbascose (CAS# 546-62-3) is an α-galactooligosaccharide with immunomodulatory activity in mouse macrophage RAW264.7 cells.<br>References Dai, Z.; et al.: J. Agric. Food. Chem., 66, 9070 (2018);<br></p>

<p>Applications 2-Amino-6,8-dihydroxypurine is an 8-oxo-guanine repair pathway coordinated by MUTYH glycosylase and DNA polymerase λ.<br>References Avkin, S., et al.: Mutat. Res., 510, 81 (2002), Niimi, N., et al.: Biochem., 48, 4239 (2009), Muftuoglu, M., et al.: J. Biol. Chem., 284, 9270 (2009),<br></p>

<p>Goat polyclonal Human ApoB antibody</p>

<p>Goat polyclonal Human Alpha 1 Antichymotrypsin antibody</p>

<p>Progesterone 3 antibody was raised in rabbit using progesterone 3-CMO-BSA as the immunogen.</p>

<p>Thyroxine antibody was raised in rabbit using thyroxine-BSA as the immunogen.</p>

<p>Purified recombinant HIV1 tat HxB2 (biotin)</p>

<p>Rabbit polyclonal HIV1 IIIB protease antibody (FITC)</p>

<p>Goat polyclonal HIV2 gp105 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth, preventing transcription and replication. Its potency has been demonstrated through the use of a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>The ST2 antibody is a monoclonal antibody that has neutralizing properties against amyloid plaque. It works by binding to dopamine growth factor, which is present in human serum. This antibody is widely used in the field of life sciences for research purposes. Additionally, it has shown potential as an antiviral medicament due to its ability to inhibit the replication of certain viruses. The ST2 antibody can be used in various applications, including immunoassays and diagnostic tests. Its high specificity and affinity make it a valuable tool for studying alpha-fetoprotein and other biomarkers. With its carbon electrode technology, this monoclonal antibody offers enhanced sensitivity and accuracy in detecting target molecules.</p>

<p>Androstenedione antibody was raised in rabbit using 4-androstene 3, 17-dione-11-protein conjugate as the immunogen.</p>

<p>Luteinizing hormone antibody was raised in rabbit using LH beta-KLH as the immunogen.</p>

<p>Goat anti Human Kappa light chain antibody</p>

<p>The CMV antibody is a monoclonal antibody that targets the endothelial growth factor in the body. It is used in life sciences research to study the role of this growth factor in various biological processes. The CMV antibody specifically binds to the nuclear component of the endothelial growth factor and blocks its activity. This antibody has been widely used in studies related to insulin resistance, autoantibodies, and anti-HER2 therapy. Additionally, it has shown potential as a therapeutic agent for inhibiting tumor growth by targeting the epidermal growth factor pathway. The CMV antibody is a valuable tool for researchers studying the mechanisms of cell proliferation and differentiation in different tissues and diseases.</p>

<p>Naproxen is a non-steroidal anti-inflammatory drug that has been used in the treatment of osteoarthritis, rheumatoid arthritis, ankylosing spondylitis, and gout. Naproxen sodium is the sodium salt of naproxen. It is a non-steroidal anti-inflammatory agent that inhibits the activity of cyclooxygenase (COX) enzymes. The rate constant for this reaction was determined by measuring the disappearance of COX enzyme from calf thymus DNA and bacterial DNA. This process is inhibited by naproxen sodium in vitro, which leads to less COX enzyme synthesis. Naproxen sodium also inhibits inflammation by inhibiting prostaglandin synthesis as well as promoting blood clotting by inhibiting platelet aggregation.</p>

<p>Sheep anti-rabbit IgG was raised in sheep using highly pure rabbit IgG as the immunogen.</p>

<p>CD4 antibody was raised in mouse using full length recombinant CD4 (T cell) produced in baculovirus expression system as the immunogen.</p>

<p>ApoB antibody was raised in mouse using human low density lipoprotein as the immunogen.</p>

<p>Rabbit polyclonal SIV gp 120 antibody (biotin); full SIV1 mac251 gp120 immunogen</p>

<p>Goat polyclonal HIV1 antibody</p>

<p>CMV antibody was raised in mouse using CMV as the immunogen.</p>

<p>C-myc antibody was raised in chicken using residues 410-419 (EQKLISEEDL) of human myc conjugated to KLH as the immunogen.</p>

<p>Estradiol antibody was raised in rabbit using estradiol-6-protein preparation as the immunogen.</p>

<p>Purified recombinant HIV1-RT protein</p>

<p>Please enquire for more information about Anti-Rubella IgM Positive Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>SIV mac251 gp120 antibody was raised in rabbit using purified, full length recombinant gp120 (SIV-1mac251) produced in baculovirus expression system as the immunogen.</p>

<p>Goat polyclonal Human CRP antibody</p>

<p>TSH antibody was raised in mouse using TSH from the human pituitary as the immunogen.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections as it exhibits bactericidal activity. This compound inhibits bacterial growth by binding to DNA-dependent RNA polymerase, thereby preventing transcription and replication. The efficacy of this drug has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, leading to inhibition of cell growth in culture.</p>

<p>cAMP antibody was raised in rabbit using succinyl-cAMP-BSA as the immunogen.</p>

<p>Guanidine thiocyanate is used as a chaotropic reagent in cell lysis buffers as it disrupts cell and organelle membranes. Guanidine thiocyanate is especially suitable for purification of nucleic acids from crude cell lysates as it is a protein denaturant, allowing for separation of nucleic acids from the protein fraction. Guanidine thiocyanate also inactivates DNAses and RNAses, giving favourable yields of nucleic acids.</p>

<p>Mouse monoclonal HIV2 gp26 antibody</p>

<p>Please enquire for more information about Anti-Rubella IgM Positive Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, which ultimately hampers bacterial growth. Extensive research has demonstrated its effectiveness through various techniques such as the patch-clamp technique on human erythrocytes. Metabolically, it undergoes several transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>Rabbit polyclonal BNP antibody</p>

<p>HPV11 antibody was raised in mouse using papilloma virus type 11 as the immunogen.</p>

<p>Mouse monoclonal HIV1-RT antibody (biotin)</p>

<p>CEA antibody was raised in mouse using human colon adrenocarcinoma as the immunogen.</p>

<p>HIV1 Nef antibody was raised in mouse using full length nef (HIV-1, ELI) as the immunogen.</p>

<p>Mouse monoclonal HIV-1 antibody; IgG2b</p>

<p>Elastase antibody was raised in rabbit using elastase as the immunogen.</p>

<p>Purified recombinant HIV2 gp105 ROD (biotin)</p>

<p>Purified recombinant HIV2 gp105 protein</p>

<p>HIV1 p24 antibody (FITC) was raised in mouse using purified, full length recombinant p24 (HIV) produced in baculovirus as the immunogen.</p>

<p>Gastrin antibody was raised in rabbit using human gastrin as the immunogen.</p>

<p>HPV18 antibody was raised in mouse using papilloma virus type 18 as the immunogen.</p>

<p>Testosterone antibody was raised in sheep using 11-beta hydroxytestosterone as the immunogen.</p>

<p>The HIV1 Nef protein is a crucial component in the study of Life Sciences and has various applications in research and diagnostics. It is an antigen binding molecule that can be used in immunoassays and as a tool for studying receptor binding. The HIV1 Nef protein can be detected using colloidal or monoclonal antibodies, which specifically bind to this protein. These binding proteins are highly specific and can be used to detect the presence of the HIV1 Nef protein in samples.</p>

<p>Mouse monoclonal REV (HIV-1 HxB2, HxB3) antibody (FITC)</p>

<p>SOD antibody was raised in sheep using human SOD purified from the liver liver as the immunogen.</p>

<p>FBP antibody was raised in rabbit using bovine milk as the immunogen.</p>

<p>Morphine 6 antibody was raised in goat using 6-carboxymethyl-morphine-BSA as the immunogen.</p>

<p>Recombinant Chikungunya Wild-Type E2/E1 Chimeric Antigen is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Recombinant Chikungunya Wild-Type E2/E1 Chimeric Antigen including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Intrinsic Factor antibody was raised in rabbit using intrinsic factor as the immunogen.</p>

<p>Purified recombinant HTLV1 gp21 protein</p>

<p>Goat polyclonal Cystatin C antibody</p>

<p>Goat anti Human Kappa light chain antibody</p>

<p>CKMM antibody was raised in rabbit using human skeletal muscle purified CK-MM Isoenzyme as the immunogen.</p>

<p>Donkey polyclonal anti Human Lambda Light Chain antibody</p>

<p>FABP antibody was raised in goat using purifed FABP from human heart tissue as the immunogen.</p>

<p>Protected amino acid</p>

<p>Purified recombinant HIV1 tat HxB2 (HRP)</p>

<p>Please enquire for more information about HAV IgM Positive Plasma, IMx PC including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Purified native Human PSA/ACT Complex protein</p>

<p>PTH antibody was raised in goat using human PTH human as the immunogen.</p>

<p>Please enquire for more information about Human Plasma Positive for Anti-HAV (IgM) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds with strong bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, thereby inhibiting bacterial growth and preventing transcription and replication. Extensive research has shown its high efficacy on human erythrocytes using a patch-clamp technique.</p>

<p>Estrone 6 antibody was raised in rabbit using estrone -6-oxime protein preparation as the immunogen.</p>

<p>CMV antibody was raised in mouse using CMV as the immunogen.</p>

<p>FSH antibody was raised in mouse using highly purified FSH as the immunogen.</p>

<p>hCG alpha antibody was raised in rabbit using hCG alpha as the immunogen.</p>

<p>FITC antibody was raised in rabbit using fluorescein isothiocyanate-KLH as the immunogen.</p>

<p>Donkey anti-goat IgG was raised in donkey using highly pure goat IgG as the immunogen.</p>

<p>CRP antibody was raised in Goat using C-Reactive Protein purified from normal human Plasma/Serum as the immunogen.</p>

<p>The HIV1 gp41 protein is a target for inhibitors in the treatment of HIV/AIDS. It plays a crucial role in viral entry into host cells by mediating fusion between the viral and cellular membranes. Inhibiting this protein can prevent viral replication and spread.</p>

<p>Brain natriuretic peptide (BNP) circulates in blood as a peptide hormone with natriuretic, vasodilatory and renin inhibitory properties. BNP is secreted predominantly by the left ventricular myocytes in response to volume expansion and pressure overload. BNP belongs to a family of structurally similar peptide hormones, which includes atrial natriuretic peptide (ANP), BNP, C type natriuretic peptide (CNP) and urodilatin.</p>

<p>Goat polyclonal FABP antibody</p>

<p>The HIV1 tat antibody is a protein that belongs to the oncostatin and natriuretic family. It acts as a kinase inhibitor and is available as both a monoclonal antibody and polyclonal antibodies in the field of Life Sciences. This antibody specifically targets the tat protein of HIV-1, which plays a crucial role in viral replication and immune evasion. By binding to the tat protein, this antibody inhibits its function and prevents viral replication.</p>

<p>PTH antibody was raised in goat using human PTH as the immunogen.</p>

<p>Polyclonal Phosphotyrosine antibody</p>

<p>HSV1 + HSV2 ICP35 antibody was raised in mouse using herpes simplex virus ICP35 as the immunogen.</p>

<p>HIV1 p24 antibody (IgG purified) was raised in sheep using purified full length recombinant p24 as the immunogen.</p>

<p>H-CSCSSWLDKECVYFCHLDIIWVNTPEQTAPYGLGNPP-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>

<p>Purified recombinant HIV1 tat HxB2 (FITC)</p>

<p>Peptide H-GISYGRQ^LG^KK^KHRR^RAHQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-SHGQDYLVGNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>HIV1 gp120 antibody was raised in rabbit using full length recombinant gp120 (HIV-1) as the immunogen.</p>

<p>TSH antibody was raised in goat using human TSH whole molecule as the immunogen.</p>

<p>Goat anti Human IgE antibody</p>

<p>Ketoconazole is a versatile powder that has neutralizing properties and can be used in various applications in the Life Sciences field. It is commonly used as a growth factor in Biological Reagents, where it promotes the growth and development of cells. Additionally, ketoconazole is known for its ability to interact with antibodies, including monoclonal antibodies and trifunctional antibodies, enhancing their effectiveness.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Orientia Tsutsugamushi p56 Antigen, Recombinant is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Orientia Tsutsugamushi p56 Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Orientia Tsutsugamushi p56 Antigen, Recombinant is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Orientia Tsutsugamushi p56 Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>HIV1 p24 antibody is a monoclonal antibody that specifically targets the p24 protein of the human immunodeficiency virus (HIV-1). This antibody has been widely used in research and diagnostic applications in the field of life sciences. It can be used for various purposes, such as detecting the presence of HIV-1 infection, studying viral replication and pathogenesis, and developing new therapeutic approaches. The HIV1 p24 antibody exhibits high specificity and sensitivity, making it a valuable tool for researchers and healthcare professionals working in the field of HIV/AIDS. Additionally, this antibody has cytotoxic properties that can be utilized for targeted therapy against HIV-infected cells. Its unique ability to bind to the p24 protein with high affinity makes it an essential component in the development of diagnostic tests and potential treatments for HIV/AIDS.</p>

<p>Mouse monoclonal HIV1 Nef N-terminal antibody (biotin)</p>

<p>Sheep polyclonal HIV1 p24 antibody (biotin)</p>

<p>Mouse monoclonal HIV1 rev antibody (biotin); concentration 50 ug/vial</p>

<p>Goat polyclonal Human alpha 2 Macroglobulin antibody</p>

<p>Goat polyclonal Digoxin antibody</p>

<p>Goat polyclonal Measles Virus Nucleoprotein antibody (FITC)</p>

<p>Goat anti Mouse IgG (H + L) secondary antibody (HRP)</p>

<p>Rabbit polyclonal HIV2 gp26 antibody; immunogen full length recombinant p26 (HIV-2 ROD) produced in E.coli expression system</p>

<p>Purified recombinant HIV1 rev HxB2/HxB3 (FITC)</p>

<p>ELISA kit for the detection of Rheumatoid Factor screen IgG/IgM/IgA in the research laboratory</p>

<p>The Measles Virus Nucleoprotein antibody is a monoclonal antibody that specifically targets the α-syn protein. It is widely used in life sciences research, particularly in studies related to polymerase chain reactions and cytotoxicity assays. This antibody has been shown to have high affinity and specificity for the α-syn protein, making it an ideal tool for detecting and quantifying this protein in various biological samples.</p>

<p>Testosterone 3 antibody was raised in rabbit using testosterone-3-oxime albumin as the immunogen.</p>

<p>DHEA 7 Sulfate antibody was raised in rabbit using dehydroepiandrosterone-3-sulfate-7-oxime-BSA as the immunogen.</p>

<p>Goat anti Human IgE antibody</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Purified recombinant HBsAg protein (Subtype adr)</p>

<p>Legionella Pneumophila LPS Mouse Monoclonal Antibody is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Legionella Pneumophila LPS Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Goat polyclonal Human AFP antibody</p>

<p>Calcitonin antibody is a monoclonal antibody that specifically targets calcitonin, a hormone involved in regulating calcium levels in the body. This antibody has been extensively studied and shown to have high affinity for calcitonin, making it an effective tool for research and diagnostic purposes.<br><br>One of the key characteristics of this antibody is its ability to detect autoantibodies against calcitonin in human serum. These autoantibodies are associated with certain autoimmune disorders and can provide valuable insights into disease progression and treatment options.<br><br>Additionally, this antibody has been used in studies involving basic protein research. It can effectively bind to calcitonin and other related proteins, enabling researchers to study their functions and interactions.<br><br>Moreover, the calcitonin antibody has been utilized as a tool in various immunoassays. It can be conjugated with different labels such as biotin or fluorescent dyes, allowing for easy detection and quantification of calcitonin levels in biological samples.<br><br>Furthermore, this antibody has neutral</p>

<p>hCG antibody was raised in goat using hCG affinity purified as the immunogen.</p>

<p>Mouse monoclonal HIV1-RT antibody (HRP)</p>

<p>CA 125 ELISA kit for detection of CA125 in the research laboratory</p>

<p>E. coli antibody was raised in mouse using E. coli shigatoxin as the immunogen.</p>

<p>HIV1 integrase antibody was raised in mouse using full length recombinant Integrase (HIV-1, IIIB) as the immunogen.</p>

<p>Nortestosterone antibody was raised in rabbit using 19-nortestosterone-17-KLH as the immunogen.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a potent antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, which prevents transcription and replication. Extensive research has shown its efficacy using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>Goat polyclonal Human Plasminogen antibody</p>

<p>HIV1 rev antibody (FITC) was raised in rabbit using full length recombinant rev (HIV-1, HxB2, HxB3) produced in E. coli expression system as the immunogen.</p>

<p>CRP antibody was raised in mouse using highly pure immuno grade C-RP as the immunogen.</p>

<p>Bombesin antibody was raised in rabbit using Bombesin-BSA as the immunogen.</p>

<p>Estradiol antibody was raised in goat using 17 beta estradiol-3-BSA as the immunogen.</p>

<p>HIV1 p24 antibody (biotin) was raised in goat using purified, full length recombinant p24 (HIV-1 IIIB) produced in baculovirus expression system as the immunogen.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth by preventing transcription and replication. The potency of this drug has been demonstrated through patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>Alpha-1 acid glycoprotein antibody was raised in goat using human alpha-1 acid glycoprotein as the immunogen.</p>

<p>Measles virus nucleoprotein antibody was raised in goat using full length recombinant measles virus nucleoprotein produced in baculovirus expression system as the immunogen.</p>

<p>Goat anti Human IgG Fc antibody</p>

<p>Rabbit Polyclonal HIV1 protease antibody</p>

<p>THC antibody was raised in rabbit using D8-THC-KLH as the immunogen.</p>

<p>ApoA-II antibody was raised in goat using highly purified human APO A-II as the immunogen.</p>

<p>Goat polyclonal Transferrin antibody</p>

<p>LDH antibody was raised in rabbit using porcine lactate dehydrogenase-H4 as the immunogen.</p>

<p>Mouse monoclonal HIV2 gp105 antibody (FITC)</p>

<p>PAP antibody was raised in rabbit using affinity purified PAP as the immunogen.</p>

<p>Listeria Monocytogenes Mouse Monoclonal Antibody is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Listeria Monocytogenes Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>The Ebola Virus antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that exhibits cytotoxic properties against the Ebola virus. This antibody specifically targets and neutralizes the glycoprotein present on the surface of the virus, preventing it from infecting host cells.</p>

<p>Rabbit polyclonal HIV-1 gp160 antibody</p>

<p>Human IgE antibody was raised in goat using human IgE as the immunogen.</p>

<p>Rabbit polyclonal anti-tat HIV1 antibody (Biotin)</p>

<p>Rabbit polyclonal HIV1 Rev antibody (biotin)</p>

<p>HIV1 p24 antibody (FITC) was raised in mouse using purified, full length recombinant p24 (HIV-1) produced in baculovirus expression system as the immunogen.</p>

<p>Mouse monoclonal CD8 antibody (FITC); concentration 1 mg/ml</p>

<p>ApoB antibody was raised in goat using human apolipoprotein B as the immunogen.</p>

<p>Luteinizing hormone antibody was raised in goat using human pituitary LH as the immunogen.</p>

<p>Mouse monoclonal CD8 antibody (biotin)</p>

<p>Anti-Human CGRP Monoclonal Antibody</p>

<p>Rabbit anti Human IgE is a highly effective neutralizing antibody that targets human serum. It has been specifically developed to combat the presence of autoantibodies and chemokines in the body. This antibody is widely used in the field of Life Sciences and has shown remarkable results in neutralizing agonist proteins. Additionally, Rabbit anti Human IgE has been proven to react with various proteins such as serum albumin protein and epidermal growth factor. With its high reactivity, this monoclonal antibody is an excellent tool for researchers studying cell antigens and seeking to develop targeted therapies. Trust Rabbit anti Human IgE to provide accurate and reliable results in your scientific endeavors.</p>

<p>Treponema pallidum antibody was raised in goat using Treponema pallidum as the immunogen.</p>

<p>Purified recombinant HTLV1 gp21 protein</p>

<p>Digitoxigenin antibody was raised in goat using digitoxigenin as the immunogen.</p>

<p>Mouse monoclonal CD8 antibody (HRP)</p>

<p>CD4 antibody was raised in rabbit using human T-Cell CD4 serum as the immunogen.</p>

<p>Rabbit polyclonal Phosphatidylserine antibody</p>

<p>HIV1 p24 antibody was raised in sheep using purified full length recombinant p24 as the immunogen.</p>

<p>Anti-activated leukocyte cell adhesion mlecule (ALCAM/CD116) monoclonal antibody</p>

<p>CEA antibody was raised in mouse using human colon adrenocarcinoma as the immunogen.</p>

<p>Goat anti Human IgA antibody</p>

<p>Goat anti Human IgG Fc antibody</p>

<p>Purified recombinant HIV2 gp36 ROD (FITC)</p>

<p>hCG antibody was raised in rabbit using hCG beta as the immunogen.</p>

<p>Goat anti-guinea pig IgG was raised in goat using highly pure normal guinea pig serum as the immunogen.</p>

<p>Troponin I antibody (cardiac) was raised in goat using human cardiac troponin I as the immunogen.</p>

<p>Goat polyclonal Human alpha 2 Macroglobulin antibody</p>

<p>Goat polyclonal Human Cystatin C antibody</p>

<p>Goat anti Mouse IgG antibody</p>

<p>Rabbit polyclonal Ferritin antibody</p>

<p>Goat anti Human IgA + IgD antibody</p>

<p>Goat polyclonal anti Human Lambda light chain antibody</p>

<p>Goat anti Human IgG Fc + IgD antibody</p>

<p>THC antibody was raised in sheep using tetrahydrocannabinol-KLH as the immunogen.</p>

<p>HIV1-RT antibody was raised in rabbit using full length recombinant RT (HIV-1) as the immunogen.</p>

<p>Myoglobin antibody was raised in goat using human heart myoglobin as the immunogen.</p>