Bioquímicos e reagentes

<p>Purified Polyclonal DCLRE1C antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FLCN antibody, catalog no. 70R-10331</p>

<p>Purified recombinant PLEKHF2 protein (His tag)</p>

<p>ANTP antibody was raised using the C terminal Of Antp corresponding to a region with amino acids QQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHH</p>

<p>RAB37 antibody was raised in rabbit using the middle region of RAB37 as the immunogen</p>

A synthetic peptide for use as a blocking control in assays to test for specificity of SLC22A10 antibody, catalog no. 70R-6764

<p>The IGFBP1 antibody is a powerful tool in the field of Life Sciences. This polyclonal antibody specifically targets and neutralizes insulin-like growth factor binding protein 1 (IGFBP1). IGFBP1 is a key regulator of neurotrophic factors, such as TGF-β1, and plays a crucial role in various biological processes. By blocking the activity of IGFBP1, this antibody can modulate important cellular functions including natriuretic signaling, collagen synthesis, chemokine production, protein kinase activation, and nuclear events. Whether you are conducting research or developing therapeutics, the IGFBP1 antibody is an invaluable asset that can help unravel the complex mechanisms underlying various diseases and pave the way for novel treatments.</p>

<p>The BAD antibody is a powerful tool used in molecular signaling research. It specifically targets the amyloid protein and is commonly used to study its function and role in various cellular processes. This antibody is available as both monoclonal and polyclonal antibodies, allowing researchers to choose the best option for their experiments.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C1orf166 antibody, catalog no. 70R-5998</p>

<p>Triosephosphate isomerase antibody is an antigen-specific antibody that specifically targets triosephosphate isomerase, a key enzyme involved in glycolysis. It is available as both polyclonal and monoclonal antibodies. These antibodies are widely used in life sciences research for various applications, including Western blotting, immunohistochemistry, and ELISA assays. Triosephosphate isomerase antibody can be used to study the expression and localization of triosephosphate isomerase in different tissues and cell types. It can also be used to investigate the role of triosephosphate isomerase in metabolic pathways and its potential as a therapeutic target. This antibody has been validated for its specificity and sensitivity, ensuring accurate and reliable results in experimental studies. Whether you are studying cellular processes, protein-protein interactions, or disease mechanisms, triosephosphate isomerase antibody will be a valuable tool in your research endeavors.</p>

<p>Rabbit polyclonal ITPKB antibody</p>

<p>C20ORF144 antibody was raised using the middle region of C20Orf144 corresponding to a region with amino acids EARRPEEGGARAALSWPRLLSRFRSPGKAPREAGPAEEQPRKRCRCPRPQ</p>

Suprofen (USP grade powder) chemical reference substance

<p>ADORA2A antibody was raised in rabbit using the C terminal of ADORA2A as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FBXW8 antibody, catalog no. 70R-3252</p>

<p>The PKM2 antibody is a monoclonal antibody that has been developed for use in various research applications. It specifically targets the PKM2 protein, which plays a crucial role in glycolysis and tumorigenesis. This antibody has been extensively tested and validated for its specificity and sensitivity.</p>

NDUFB11 antibody was raised in Rabbit using Human NDUFB11 as the immunogen

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HSD17B14 antibody, catalog no. 70R-4347</p>

<p>Mouse monoclonal Basal Cell Cytokeratin antibody</p>

<p>Rabbit polyclonal ZNF384 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of OR6C68 antibody, catalog no. 70R-6774</p>

<p>DLL4 antibody was raised using a synthetic peptide corresponding to a region with amino acids QGSLAVGQNWLLDEQTSTLTRLRYSYRVICSDNYYGDNCSRLCKKRNDHF</p>

<p>The NDKA antibody is a highly specialized monoclonal antibody that targets the galectin-3 glycoprotein. It is activated by interferon and has been extensively studied in the field of Life Sciences. This antibody has shown great potential for use in the treatment of various diseases, including autoimmune disorders and certain types of cancer.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ANP32A antibody, catalog no. 70R-1646</p>

<p>Rabbit polyclonal DRD1 antibody</p>

<p>Sheep polyclonal Lorazepam antibody</p>

<p>ZNF662 antibody was raised in rabbit using the middle region of ZNF662 as the immunogen</p>

<p>Csrp2 antibody was raised in rabbit using the middle region of Csrp2 as the immunogen</p>

<p>Purified recombinant ASMT protein</p>

<p>RG9MTD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KKARQIKKEMKAAAREEAKNIKLLETTEEDKQKNFLFLRLWDRNMDIAMG</p>

<p>IGF BP3 antibody was raised in rabbit using highly pure recombinant human IGF-BP3 as the immunogen.</p>

<p>Affinity purified Rabbit polyclonal COX5B antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C6orf199 antibody, catalog no. 70R-3324</p>

<p>MFSD4 antibody was raised using the N terminal of MFSD4 corresponding to a region with amino acids FGALLSPLIADPFLSEANCLPANSTANTTSRGHLFHVSRVLGQHHVDAKP</p>

<p>The CCL22 antibody is a serine protease that belongs to the family of antibodies. It is commonly found in human serum and can be used as a polyclonal antibody for various applications. This antibody specifically targets and neutralizes the activated form of CCL22, which is a growth factor involved in inflammatory responses. By binding to CCL22, this antibody inhibits its activity and prevents it from promoting inflammation. Additionally, the CCL22 antibody has been shown to have antiangiogenic properties, making it a valuable tool in life sciences research. Whether you need to study the role of CCL22 in disease progression or investigate its interactions with other molecules, this monoclonal antibody is an essential tool for your experiments. With its high specificity and affinity, it ensures accurate results and reliable data. Order your CCL22 antibody today and unlock new insights into cellular signaling pathways and immune responses.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SAMD14 antibody, catalog no. 70R-4194</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NUDT9 antibody, catalog no. 70R-5104</p>

<p>Rabbit polyclonal STAT1 antibody (Tyr701)</p>

<p>Rabbit polyclonal REEP5 antibody</p>

<p>Mouse monoclonal LCMT1 antibody</p>

<p>PMS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids INKKVVPLDFSMSSLAKRIKQLHHEAQQSEGEQNYRKFRAKICPGENQAA</p>

<p>Rabbit polyclonal POLR1C antibody</p>

<p>SNAG1 antibody was raised in rabbit using the middle region of SNAG1 as the immunogen</p>

<p>The BTN1A1 antibody is a monoclonal antibody that targets β-catenin, a protein involved in cell adhesion and signaling pathways. This antibody acts as a family kinase inhibitor, preventing the activation of downstream signaling pathways and inhibiting cell growth. It has been shown to be cytotoxic to cancer cells and can enhance the effects of interferon and other growth factor inhibitors. The BTN1A1 antibody specifically recognizes a virus surface antigen expressed on certain cancer cells, making it a valuable tool for targeted therapy. With its high specificity and affinity, this antibody is widely used in life sciences research, particularly in studies related to epidermal growth factor signaling and histidine metabolism. Its versatility and effectiveness make it an essential component in many antibody-based assays and experiments.</p>

<p>The HSP27 antibody is a powerful tool used in Life Sciences research. It is a monoclonal antibody that specifically targets and neutralizes HSP27, a protein involved in various cellular processes. HSP27 plays a crucial role in calcium binding, cytotoxicity, and the regulation of epidermal growth factor. By targeting HSP27, this antibody can inhibit its function and provide valuable insights into its role in different biological systems.</p>

<p>Rat monoclonal CD62L antibody (PE)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SERTAD2 antibody, catalog no. 70R-9094</p>

<p>Rabbit polyclonal SOX8 antibody</p>

<p>Mouse monoclonal LDLRAP1 antibody</p>

<p>RABEPK antibody was raised using the N terminal of RABEPK corresponding to a region with amino acids SCSYLPPVGNAKRGKVFIVGGANPNRSFSDVHTMDLGKHQWDLDTCKGLL</p>