Bioquímicos e reagentes

<p>DHX8 antibody was raised using a synthetic peptide corresponding to a region with amino acids VKNGAEFTDSLISNLLRLIQTMRPPAKPSTSKDPVVKPKTEKEKLKELFP</p>

<p>D930005D10RIK antibody was raised in rabbit using the C terminal of D930005D10RIK as the immunogen</p>

<p>ADCYAP1R1 antibody was raised in rabbit using the C terminal of ADCYAP1R1 as the immunogen</p>

<p>RDM1 antibody was raised using the middle region of RDM1 corresponding to a region with amino acids NSSKCQELANYYFGFNGCSKRIIKLQELSDLEERENEDSMVPLPKQSLKF</p>

<p>IFRD1 antibody was raised using the N terminal of IFRD1 corresponding to a region with amino acids VQPFSDEDASIETMSHCSGYSDPSSFAEDGPEVLDEEGTQEDLEYKLKGL</p>

<p>Utx antibody was raised in rabbit using the N terminal of Utx as the immunogen</p>

<p>Mouse monoclonal LPDA antibody</p>

<p>Mouse monoclonal GSTO2 antibody</p>

<p>Protein C antibody was raised using a synthetic peptide corresponding to a region with amino acids PCGRPWKRMEKKRSHLKRDTEDQEDQVDPRLIDGKMTRRGDSPWQVVLLD</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG.</p>

<p>Recombinant Human HDDC2 protein</p>

<p>Mouse monoclonal PACSIN3 antibody</p>

<p>Purified recombinant TREM2 protein (His tag)</p>

<p>Cholic acid monoclonal antibody is a powerful tool in the field of Life Sciences. This antibody specifically targets and binds to endothelial growth factor, which plays a crucial role in angiogenesis and blood vessel formation. By binding to activated endothelial growth factor, this monoclonal antibody inhibits its function and prevents the growth of new blood vessels.</p>

<p>Rabbit polyclonal ATF1 antibody</p>

<p>The CD49e antibody is a monoclonal antibody that has various applications in the field of Life Sciences. It has been shown to interact with oncostatin and epidermal growth factor, leading to the modulation of cell signaling pathways. Additionally, the CD49e antibody has been found to regulate E-cadherin expression, which plays a crucial role in cell adhesion and migration.</p>

<p>Rat monoclonal NKG2D antibody (allophycocyanin)</p>

<p>N-Pivaloyl-L-tyrosine is a synthetic peptide that acts as an activator of the P2Y receptor. It is a white, crystalline powder that is soluble in organic solvents. This product is used in pharmacological research as a tool to study protein interactions and ion channels.</p>

<p>Rabbit polyclonal CSRP1 antibody (HRP)</p>

<p>CAPN5 antibody was raised in Rabbit using Human CAPN5 as the immunogen</p>

<p>Mouse monoclonal Tricyclic Antidepressants antibody</p>

<p>Mouse monoclonal SulT2A1 antibody</p>

<p>Rabbit polyclonal Gag-Pol antibody (biotin)</p>

<p>Mouse monoclonal HDHD2 antibody</p>

<p>Purified recombinant CTSE protein (His tag)</p>

<p>The TBLR1 antibody is a monoclonal antibody that belongs to the class of chemokine antibodies. It is widely used in the field of Life Sciences for various research applications. This antibody specifically targets TBLR1, which is a protein involved in several cellular processes. It has been shown to interact with vasoactive intestinal peptide (VIP), an important regulator of immune responses and inflammation. The TBLR1 antibody has also been found to inhibit the activity of egf-like proteins, which play a crucial role in cell growth and development. Furthermore, this antibody has high affinity for human serum albumin, making it an ideal tool for studying protein-protein interactions and drug delivery systems. Its inhibitory effect on family kinases and interleukin-6 further enhances its potential therapeutic applications.</p>

<p>The MYBL2 antibody is a powerful tool used in Life Sciences research. It is a polyclonal antibody that specifically targets the nuclear protein MYBL2, which plays a crucial role in cell growth and division. MYBL2 is known to interact with various factors such as epidermal growth factor (EGF) and tumor necrosis factor-alpha (TNF-α), regulating important cellular processes.</p>

<p>Purified Polyclonal PLC gamma 1 antibody</p>

<p>Laminin Gamma 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KTREAQQALGSAAADATEAKNKAHEAERIASAVQKNATSTKAEAERTFAE</p>

<p>SLC41A2 antibody was raised using the N terminal of SLC41A2 corresponding to a region with amino acids SCSQKYDDYANYNYCDGRETSETTAMLQDEDISSDGDEDAIVEVTPKLPK</p>

<p>STX4 antibody was raised in rabbit using the C terminal of STX4 as the immunogen</p>

<p>The Smad2 antibody is a highly specialized antibody used in the field of Life Sciences. It is a polyclonal antibody that specifically targets alpha-fetoprotein and alpha-synuclein, two important proteins involved in various cellular processes. This antibody is commonly used in research studies to investigate the role of these proteins in different diseases and conditions.</p>

<p>AGTR2 antibody was raised in rabbit using the N terminal of AGTR2 as the immunogen</p>

<p>Mouse monoclonal DNAJA2 antibody</p>

<p>Rabbit polyclonal ROPN1L antibody</p>

<p>CDC23 antibody was raised using a synthetic peptide corresponding to a region with amino acids DTREEGKALLRQILQLRNQGETPTTEVPAPFFLPASLSANNTPTRRVSPL</p>

<p>CCR4 antibody was raised in rabbit using a synthetic peptide DTTQDETVYNSYYFYESMP-C corresponding to amino acid residues 8-26 of mouse CCR4 as the immunogen.</p>

<p>CARD9 antibody was raised in Rabbit using Human CARD9 as the immunogen</p>

<p>Rabbit polyclonal NFAT5 antibody (Ser1197)</p>

<p>USP4 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Purified recombinant LPCAT1 protein (His tag)</p>

<p>Desmin antibody is a monoclonal antibody that specifically targets and binds to desmin, a protein involved in cell growth and maintenance. Desmin antibody has been widely used in research and diagnostics to study various cellular processes, including epidermal growth factor signaling, nuclear localization, and tyrosine phosphorylation. It is also commonly used as a primary antibody in immunohistochemistry and Western blotting experiments. Additionally, desmin antibody has shown potential therapeutic applications as an anti-HER2 antibody-drug conjugate, in combination with other antibodies such as trastuzumab. Its use as a research tool has provided valuable insights into the role of desmin in diseases such as cancer, fatty acid metabolism disorders, c-myc overexpression, and neurodegenerative disorders involving alpha-synuclein aggregation.</p>

<p>Purified recombinant EEF2 protein (His tag)</p>

<p>Mouse monoclonal MGRN1 antibody</p>

<p>The PABP antibody is a highly specific and versatile tool used in Life Sciences research. It is designed to target and bind to the poly(A) binding proteins (PABPs), which play a crucial role in mRNA stability, translation, and other cellular processes. This antibody can be used for various applications such as immunoprecipitation, Western blotting, immunofluorescence, and flow cytometry.</p>

<p>MGC4172 antibody was raised using the C terminal of MGC4172 corresponding to a region with amino acids VETQFAFKLHDKDPEKAAATYEQMKCLKPEDVAEAVIYVLSTPAHIQIGD</p>

<p>C11ORF24 antibody was raised using the N terminal Of C11Orf24 corresponding to a region with amino acids SPVTLTKGTSAAHLNSMEVTTEDTSRTDVSEPATSGGAADGVTSIAPTAV</p>

<p>Hoxb9 antibody was raised in rabbit using the middle region of Hoxb9 as the immunogen</p>

<p>Rabbit Polyclonal ETFDH antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of WWP2 antibody, catalog no. 70R-2783</p>