Bioquímicos e reagentes

<p>Rabbit polyclonal SLPI antibody (FITC)</p>

<p>HIP2 antibody was raised in mouse using recombinant Human Huntingtin Interacting Protein 2 (Hip2)</p>

<p>Rabbit polyclonal Alpha synuclein antibody (HRP)</p>

<p>NUFIP1 antibody was raised in mouse using recombinant Human Nuclear Fragile X Mental Retardation Protein Interacting Protein 1</p>

<p>HIVEP1 antibody was raised in mouse using recombinant Human Human Immunodeficiency Virus Type I Enhancer Binding Protein 1</p>

<p>Rabbit polyclonal Gamma enolase antibody (biotin)</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, thus inhibiting bacterial growth and preventing transcription and replication. Extensive research has been conducted on human erythrocytes using a patch-clamp technique, demonstrating its high frequency of human activity. In terms of metabolism, it undergoes various transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting cell growth in culture.</p>

<p>Telomerase antibody is a monoclonal antibody that specifically targets the telomerase enzyme. Telomerase plays a crucial role in maintaining the length of telomeres, which are protective caps at the ends of chromosomes. This antibody binds to the catalytic subunit of telomerase and inhibits its activity, leading to telomere shortening and eventual cell death.</p>

<p>Purified Rabbit polyclonal EEF1E1 antibody</p>

<p>GCN5L2 antibody was raised in mouse using recombinant human GCN5L2 (411-837aa) purified from E. coli as the immunogen.</p>

<p>SUPT4H1 antibody was raised in mouse using recombinant Human Suppressor Of Ty 4 Homolog 1 (S. Cerevisiae) (Supt4H1)</p>

<p>Bcl-2 antibody was raised in mouse using recombinant human Bcl-2 (1-211aa) purified from E. coli as the immunogen.</p>

<p>ADNP antibody was raised in mouse using recombinant Human Activity-Dependent Neuroprotector Homeobox</p>

<p>Rabbit polyclonal CXCL10 antibody (HRP)</p>

<p>Purified Polyclonal HMGA1 antibody</p>

<p>Rabbit polyclonal Wheat Gliadin antibody (HRP)</p>

<p>Purified Rabbit polyclonal OR6C70 antibody</p>

<p>ARID4A antibody was raised in mouse using recombinant Human At Rich Interactive Domain 4A (Rbp1-Like) (Arid4A)</p>

<p>The Human Serum amyloid A monoclonal antibody is a powerful therapeutic agent with antioxidant activity. This monoclonal antibody specifically targets human serum and has been extensively studied in the field of Life Sciences. It exhibits strong inhibitory effects on protein kinase, which plays a crucial role in various cellular processes. The Human Serum amyloid A monoclonal antibody is designed using advanced techniques such as DNA aptamers and cyclic peptides, ensuring high specificity and efficacy. Through molecular docking studies, its pharmacodynamics properties have been thoroughly investigated, making it an ideal candidate for targeted therapy. Additionally, this antibody has shown promising results in inhibiting the growth factor signaling pathways associated with certain diseases. With its industrial applications and potential use in research and clinical settings, the Human Serum amyloid A monoclonal antibody represents a significant advancement in the field of Antibodies.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TMEM59L antibody, catalog no. 70R-1898</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of WDR51B antibody, catalog no. 70R-3215</p>

<p>SF3B1 antibody was raised using the middle region of SF3B1 corresponding to a region with amino acids LLNDIPQSTEQYDPFAEHRPPKIADREDEYKKHRRTMIISPERLDPFADG</p>

<p>Rabbit polyclonal TP53 antibody (Ser392)</p>

<p>ETF1 antibody was raised in Rabbit using Human ETF1 as the immunogen</p>

<p>PLEKHA1 antibody was raised using the N terminal of PLEKHA1 corresponding to a region with amino acids LNKAIKITVPKQSDSQPNSDNLSRHGECGKKQVSYRTDIVGGVPIITPTQ</p>

<p>The SYK antibody is a highly specific antibody used in Life Sciences research. It is available as both polyclonal and monoclonal antibodies. This antibody targets the spleen tyrosine kinase (SYK), a protein involved in various cellular processes.</p>

<p>The NF kappaB p65 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It specifically targets the NF kappaB p65 protein, which is a key regulator of gene expression involved in various cellular processes such as growth factor signaling, immune response, and inflammation.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RAD23B antibody, catalog no. 70R-3307</p>

<p>The CNP antibody is a highly specialized antibody used in the field of Life Sciences. It has a wide range of applications and functions, including the detection and quantification of specific proteins and molecules. This antibody is particularly effective in identifying phalloidin, superoxide, endothelial growth factors, chemokines, growth factors, dopamine, and collagen.</p>

<p>Factor IX antibody was raised in goat using human Factor IX purified from plasma as the immunogen.</p>

<p>Region of Lymphotactin protein corresponding to amino acids GSEVSDKRTC VSLTTQRLPV SRIKTYTITE GSLRAVIFIT KRGLKVCADP QATWVRDVVR SMDRKSNTRN NMIQTKPTGT QQSTNTAVTL TG.</p>

<p>Rabbit polyclonal DGKZ antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC29A2 antibody, catalog no. 70R-7165</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HSPB1 antibody, catalog no. 20R-1061</p>

<p>The Sonic Hedgehog protein is a key regulator of various cellular processes, including endothelial growth and actin filament organization. It has been shown to play a crucial role in embryonic development and tissue repair. Sonic Hedgehog protein can activate chemokine receptors and induce the production of growth factors, such as erythropoietin and collagen. Additionally, this protein has antioxidant properties and can protect against oxidative damage caused by superoxide and dopamine. Recombinant Sonic Hedgehog protein is available for research purposes in the field of Life Sciences. It can be used in experiments studying cell signaling pathways, tissue regeneration, and angiogenesis. Ketanserin, a monoclonal antibody, has been developed to specifically target Sonic Hedgehog protein for therapeutic applications. Explore our wide range of Proteins and Antigens to enhance your research in this exciting field.</p>

<p>NAE1 antibody was raised in Rabbit using Human NAE1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GALC antibody, catalog no. 70R-7164</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DUT antibody, catalog no. 70R-1053</p>

<p>NOC3L antibody was raised using a synthetic peptide corresponding to a region with amino acids TLKKYRKEQRKLRQAVKDAVSKKPIPLENPKEKRPGKRIEREEEEEEEAL</p>

<p>Goat anti-human IgG (H+L) (Alk Phos) was raised in goat using human IgG, whole molecule as the immunogen.</p>

<p>CYP46A1 antibody was raised in Rabbit using Human CYP46A1 as the immunogen</p>

<p>Rabbit polyclonal Cyclin D2 antibody</p>

<p>FBXO39 antibody was raised using the N terminal of FBXO39 corresponding to a region with amino acids DRSRAALVCRKWNQMMYSAELWRYRTITFSGRPSRVHASEVESAVWYVKK</p>

<p>FXYD3 antibody was raised in Rabbit using Human FXYD3 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SH3BP4 antibody, catalog no. 70R-3657</p>

<p>ATP6V1C1 antibody was raised in Rabbit using Human ATP6V1C1 as the immunogen</p>

<p>Purified recombinant Human EIF1AY protein</p>

<p>NRCAM antibody was raised using the N terminal of NRCAM corresponding to a region with amino acids NLSDTEFYGAKSSRERPPTFLTPEGNASNKEELRGNVLSLECIAEGLPTP</p>

<p>PPP5C antibody was raised in rabbit using the middle region of PPP5C as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GP9 antibody, catalog no. 70R-10332</p>