Bioquímicos e reagentes

<p>CITED4 antibody was raised in rabbit using the N terminal of CITED4 as the immunogen</p>

<p>MQQQTLPKPF IWAEPHFMVP KEKQVTICCQ GNYGAVEYQL HFEGSLFAVD RPKPPERINK VKFYIPDMNS RMAGQYSCIY RVGELWSEPS NLLDLVVTEM YDTPTLSVHP GPEVISGEEV TFYCRLDTAT SMFLLLKEGR SSHVQRGYGK VQAEFPLGPV TTAHRGTYRX FGSYNNHAWS FPSEPVKLLV TGDIENTSLA PEDPTFSADT WGTYLLTTET GLQKDHALWD HTAQN</p>

<p>The MIOX antibody is a highly specialized monoclonal antibody that targets the tyrosine kinase receptor. It acts by inhibiting the activity of this receptor, which plays a crucial role in cell growth and division. By blocking the receptor, the MIOX antibody effectively prevents the activation of downstream signaling pathways that promote tumor growth.</p>

<p>Rabbit polyclonal OR5H6 antibody</p>

<p>GTPBP9 antibody was raised using a synthetic peptide corresponding to a region with amino acids QGLGNAFLSHISACDGIFHLTRAFEDDDITHVEGSVDPIRDIEIIHEELQ</p>

<p>RTN1 antibody was raised using the middle region of RTN1 corresponding to a region with amino acids MAVVSMFTLPVVYVKHQAQIDQYLGLVRTHINAVVAKIQAKIPGAKRHAE</p>

<p>Antimicrobial Bronidox solution</p>

<p>NFKBIL1 antibody was raised in rabbit using the N terminal of NFKBIL1 as the immunogen</p>

<p>RNF182 antibody was raised using the N terminal of RNF182 corresponding to a region with amino acids CLPDDEVSSLPDDNNILVNLTCGGKGKKCLPENPTELLLTPKRLASLVSP</p>

<p>Rabbit polyclonal GHITM antibody</p>

<p>BCAP29 antibody was raised using the middle region of BCAP29 corresponding to a region with amino acids GVMEPQQRNADSHQKLEEAKNRFFPRASSSRSMALQIPIKLILDFLASRT</p>

<p>Mouse monoclonal AKR1A1 antibody</p>

<p>The USP16 antibody is a highly specialized monoclonal antibody that plays a crucial role in various life sciences applications. This antibody is specifically designed to target and neutralize the activity of USP16, an enzyme involved in mineralization and adipose tissue development. It has been widely used in immunoassays and research studies to investigate the function and regulation of USP16.</p>

<p>Purified Polyclonal Caspase 6 p18 antibody</p>

<p>Purified Polyclonal CAMK2A antibody</p>

<p>Recombinant Human TOM1L2 protein (His tag)</p>

<p>THETA allo-antiserum antibody was raised in mouse using mouse C3H/He thymocytes as the immunogen.</p>

<p>Goat anti-mouse IgG (H + L) (Agarose Conjugated) was raised in goat using murine IgG whole molecule as the immunogen.</p>

<p>Calbindin 2 antibody was raised using the N terminal of CALB2 corresponding to a region with amino acids IIGEEDLPSEEVDQELIEDSQWEEILKQPCPSQYSAIKEEDLVVWVDPLD</p>

<p>ZNF75A antibody was raised in rabbit using the N terminal of ZNF75A as the immunogen</p>

<p>COPA antibody was raised using the middle region of COPA corresponding to a region with amino acids IPKDADSQNPDAPEGKRSSGLTAVWVARNRFAVLDRMHSLLIKNLKNEIT</p>

<p>Mouse monoclonal TUBAL3 antibody</p>

<p>Mouse monoclonal Hygromycin phosphotransferase antibody</p>

<p>Rabbit Polyclonal OPRD1 antibody</p>

<p>RHOT1 antibody was raised using the N terminal of RHOT1 corresponding to a region with amino acids MKKDVRILLVGEPRVGKTSLIMSLVSEEFPEEVPPRAEEITIPADVTPER</p>

<p>Rabies protein is a monoclonal antibody that is commonly used in research and diagnostic applications. It can be used in various techniques such as polymerase chain reaction (PCR) and electrophoresis to detect the presence of specific proteins or antigens. This protein has cytotoxic properties, making it useful for studying cellular processes and evaluating the effects of test substances on different cell types. Additionally, rabies protein has been studied in relation to cardiac muscle troponin and its interaction with cardiomyocytes. It has also been used in studies involving multidrug resistance, as well as in the field of life sciences for exploring the effects of glucagon and pioglitazone on cellular processes. With its versatility and wide range of applications, rabies protein is an essential tool for researchers in various fields.</p>

<p>TBX21 antibody is a monoclonal antibody used in Life Sciences research. It targets the TBX21 protein, which acts as a methyl transferase and is involved in various cellular processes. This antibody has been shown to be effective in inhibiting the activity of TBX21, leading to altered gene expression patterns and cellular functions. Additionally, TBX21 antibody has been used to study the role of TBX21 in collagen synthesis, nuclear signaling pathways, and retinoid metabolism. It can also be used as a tool for investigating potential therapeutic applications and developing vaccines targeting specific strains of pathogens. With its high specificity and potency, TBX21 antibody is a valuable tool for researchers in the field of Life Sciences.</p>

<p>Dopamine-BSA is a peptide agent that consists of dopamine conjugated with Bovine Serum Albumin (BSA). It is commonly used in life sciences research for various applications. Dopamine-BSA has been found to interact with collagen, antibodies, and angiotensin-converting enzyme. It can also be used as a tool for studying the role of dopamine in different biological processes.</p>

<p>The NMT2 antibody is a monoclonal antibody that specifically targets leukemia inhibitory factor (LIF). LIF is a glycoprotein that plays a crucial role in various biological processes, including cell proliferation and differentiation. This antibody has been shown to neutralize the activity of LIF, making it a potential therapeutic option for conditions where LIF overexpression is implicated.</p>

<p>Rabbit polyclonal OVCA1 antibody</p>

<p>Mouse monoclonal CORO1B antibody</p>

<p>Purified recombinant RPL22 protein (His tag)</p>

<p>The HAMA Blocking Reagent is a reactive compound commonly used in Life Sciences research. It is designed to block the interference caused by Human Anti-Mouse Antibodies (HAMA) in various assays and experiments.</p>

<p>Rabbit polyclonal ARF4 antibody</p>

<p>ZNF778 antibody was raised in rabbit using the N terminal of ZNF778 as the immunogen</p>

<p>Purified Rabbit polyclonal INSP3 antibody (Ser1598/1588)</p>

<p>Rabbit polyclonal AIRE antibody</p>

<p>GRO beta antibody was raised in rabbit using highly pure recombinant rat GRObeta/MIP-2 as the immunogen.</p>

<p>Rabbit polyclonal TBC1D5 antibody</p>

<p>The PAK2 antibody is a monoclonal antibody that specifically targets the insulin receptor, a nuclear receptor that plays a crucial role in regulating growth factors and insulin signaling pathways. This antibody binds to the insulin receptor and inhibits its activity, thereby modulating the response to insulin. The PAK2 antibody has been extensively studied in various life sciences research applications, including studies on dopamine signaling, protein synthesis, thymidylate synthesis, and epidermal growth factor signaling. Additionally, this antibody has shown potential therapeutic value in targeting specific proteins such as anti-HER2 antibodies and autoantibodies found in human serum. With its high specificity and versatility, the PAK2 antibody is an invaluable tool for researchers in the field of molecular biology and immunology.</p>

<p>The mGLUR5 antibody is a monoclonal antibody that specifically targets and binds to the metabotropic glutamate receptor 5 (mGLUR5). This antibody is widely used in research and diagnostic applications to study the function and expression of mGLUR5. It has been shown to be effective in detecting autoantibodies in human serum, including anti-thyroglobulin antibodies. The mGLUR5 antibody also exhibits high affinity for sorafenib, a growth factor receptor inhibitor, and demonstrates strong binding to serum albumin due to its reactive disulfide bond and cationic properties. Additionally, this specific antibody has been successfully used in studies involving phosphatase activity.</p>

<p>PPAR gamma antibody is a specific antibody that targets the peroxisome proliferator-activated receptor gamma (PPAR gamma). This antibody is widely used in Life Sciences research to study the functions and signaling pathways of PPAR gamma. PPAR gamma plays a crucial role in regulating gene expression involved in adipogenesis, insulin sensitivity, lipid metabolism, and inflammation. The PPAR gamma antibody has been shown to inhibit IL-17A-induced growth factor secretion in granulosa cells and promote the expression of E-cadherin. It can also be used for immunohistochemistry and immunofluorescence experiments to detect PPAR gamma expression levels in various tissues and cell types. This monoclonal antibody offers high specificity and sensitivity, making it an essential tool for researchers studying PPAR gamma-related diseases such as obesity, diabetes, and cancer.</p>

<p>Rabbit polyclonal MCM4 antibody</p>

<p>Mouse monoclonal MAPK1 antibody</p>

<p>DEDD2 antibody was raised in rabbit using residues 144-129 of the DEDD2 protein as the immunogen.</p>

<p>CAMK4 antibody was raised in Rabbit using Human CAMK4 as the immunogen</p>

<p>Symplekin antibody was raised using the N terminal of SYMPK corresponding to a region with amino acids RTHAIKFVEGLIVTLSPRMADSEIPRRQEHDISLDRIPRDHPYIQYNVLW</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>

<p>ASAP3 antibody was raised using the N terminal of ASAP3 corresponding to a region with amino acids RGAALAREEILEGDQAILQRIKKAVRAIHSSGLGHVENEEQYREAVESLG</p>

<p>The TP53 antibody is a growth factor that acts as a functional sweetener. It belongs to the class of antibodies and specifically targets the TP53 protein, which plays a crucial role in regulating cell division and preventing tumor formation. This monoclonal antibody has been extensively studied and shown to have neutralizing effects on the TP53 protein, thereby inhibiting its activity and promoting cell growth. It is widely used in life sciences research, particularly in studies related to cancer biology and immunology. The TP53 antibody has also been investigated for its potential therapeutic applications, including as a targeted treatment for certain types of cancer. Overall, this molecule drug shows great promise in advancing our understanding of cellular processes and developing novel therapies.</p>