Bioquímicos e reagentes

<p>Purified Polyclonal Calcium Sensing Receptor antibody</p>

<p>Laminin Beta 3 antibody was raised using the middle region of LAMB3 corresponding to a region with amino acids ERIKQKYAELKDRLGQSSMLGEQGARIQSVKTEAEELFGETMEMMDRMKD</p>

<p>The TOMM20 antibody is a growth factor that plays a crucial role in various biological processes. It is an antibody specifically designed to target and bind to TOMM20, an essential protein involved in mitochondrial import. This antibody can be used for research purposes in the field of life sciences, particularly in the study of mitochondrial function and dynamics.</p>

<p>ARSA antibody was raised using the middle region of ARSA corresponding to a region with amino acids KQLQLLKAQLDAAVTFGPSQVARGEDPALQICCHPGCTPRPACCHCPDPH</p>

<p>Triamcinolone Conjugate for use in immunoassays</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is particularly effective in treating tuberculosis infections due to its strong bactericidal activity. This compound inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been proven through extensive research using the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>IFITM2 antibody was raised in Rabbit using Human IFITM2 as the immunogen</p>

<p>ITM2A antibody was raised in Rabbit using Human ITM2A as the immunogen</p>

<p>Mouse monoclonal MAPRE2 antibody</p>

<p>The ST6GAL1 antibody is a polyclonal antibody commonly used in the field of Life Sciences. It is specifically designed to target and bind to the ST6GAL1 protein, which plays a crucial role in various cellular processes. This antibody has been extensively tested and validated for its high specificity and sensitivity.</p>

<p>Mouse monoclonal RNF144B antibody</p>

<p>Purified Polyclonal HOXA11/D11 antibody</p>

<p>Mouse monoclonal EIF2S1 antibody</p>

<p>The UBC9 antibody is a highly reactive protein that is used in various research applications. It specifically targets CD33, a cell surface marker that is expressed on certain immune cells. The UBC9 antibody can be used to detect and quantify CD33 levels in different samples, such as blood or tissue. This antibody is commonly used in life sciences research, particularly in studies related to calmodulin, adipose biology, 3-kinase signaling pathways, and activated immune cells. Additionally, the UBC9 antibody has been shown to have potential therapeutic applications in diseases caused by pathogens like Brucella abortus and oxidative stress-related conditions due to its ability to neutralize superoxide and modulate interleukin-6 activity. Trustworthy and reliable, the UBC9 antibody is an essential tool for researchers looking to explore various aspects of cellular biology and immunology.</p>

<p>NXF1 antibody was raised using the N terminal of NXF1 corresponding to a region with amino acids RPNRRGDTWHDRDRIHVTVRRDRAPPERGGAGTSQDGTSKNWFKITIPYG</p>

<p>CENPE Monoclonal Antibody BSA/Azide Free</p>

<p>Mouse monoclonal KCTD14 antibody</p>

<p>The MMP19 antibody is a powerful tool used in the field of Life Sciences. It specifically targets Matrix Metalloproteinase 19 (MMP19), an enzyme that plays a crucial role in various physiological processes. This antibody is widely used in research and diagnostic applications.</p>

<p>SLC4A5 antibody was raised in rabbit using the N terminal of SLC4A5 as the immunogen</p>

<p>Rabbit polyclonal EIF4A2 antibody (HRP)</p>

<p>Rabbit polyclonal RFC4 antibody</p>

<p>Purified Polyclonal GABRB1 antibody</p>

<p>SMN1 antibody is a monoclonal antibody that is widely used in Life Sciences research. It is specifically designed to target and detect Survival Motor Neuron 1 (SMN1) protein. This antibody has been extensively validated in various assays, including immunohistochemistry, Western blotting, and ELISA. SMN1 antibody can be used to study the expression and localization of SMN1 in different tissues and cell types. It has high specificity and sensitivity, ensuring accurate and reliable results. Additionally, this antibody has been shown to have minimal cross-reactivity with other proteins or molecules commonly found in human serum or biological samples. Its exceptional performance makes it an essential tool for researchers studying SMN1-related diseases or exploring the role of SMN1 in cellular processes.</p>

<p>Mouse monoclonal MMAA antibody</p>

<p>PPM1B antibody was raised using a synthetic peptide corresponding to a region with amino acids EIMEKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRNVIEAVYSRLN</p>

<p>Osteonectin protein is a crucial component in the field of Life Sciences. It is commonly used in reaction solutions and can be detected using monoclonal antibodies. This Native Protein &amp; Antigen plays a significant role in various biological processes, including cellular protein synthesis and mineralization. Osteonectin protein has been found to interact with histidine, epidermal growth factor, inhibitors, liver microsomes, and human serum. Additionally, it has been studied for its potential involvement in autoimmune diseases as autoantibodies against osteonectin have been detected. Its multifunctional nature makes it a valuable tool for research and the development of new medicines.</p>

<p>The CREB antibody is a highly specialized diagnostic reagent used in Life Sciences research. It is a monoclonal antibody that specifically targets and detects the activated form of CREB (cAMP response element-binding protein), a transcription factor involved in various cellular processes. This antibody has been extensively tested and validated for its specificity and sensitivity in detecting activated CREB in different cell types, including human hepatocytes, pluripotent stem cells, granulosa cells, and collagen-producing cells.</p>

<p>Rabbit polyclonal TCIRG1 antibody</p>

<p>Purified Polyclonal CDC8 antibody</p>

<p>Mouse monoclonal LIPG antibody</p>

<p>RASGEF1A antibody was raised using the N terminal of RASGEF1A corresponding to a region with amino acids TFLLSSRVFMPPHDLLARVGQICVEQKQQLEAGPEKAKLKSFSAKIVQLL</p>

<p>Mouse monoclonal TTLL12 antibody</p>

<p>Mouse monoclonal TOMM34 antibody</p>

<p>CRMP1 antibody was raised using the N terminal of CRMP1 corresponding to a region with amino acids SYQGKKSIPHITSDRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLIV</p>

<p>Tachykinin receptor NK2 antagonist</p>

<p>TTC14 antibody was raised using the N terminal of TTC14 corresponding to a region with amino acids MDRDLLRQSLNCHGSSLLSLLRSEQQDNPHFRSLLGSAAEPARGPPPQHP</p>

<p>This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.</p>

<p>DERL3 antibody was raised using the C terminal of DERL3 corresponding to a region with amino acids YYFLEDVFPNQPGGKRLLQTPGFLKLLLDAPAEDPNYLPLPEEQPGPHLP</p>

<p>Bcl-G antibody was raised in rabbit using residues 298-312 [TKYLKENFSPWIQQH] of the human BCL-G Long form protein as the immunogen.</p>

<p>TTMB antibody was raised using the N terminal Of Ttmb corresponding to a region with amino acids AGYWPHRAGAPGSRAANASSPQMSELRREGRGGGRAHGPHERLRLLGPVI</p>

<p>Slc22a3 antibody was raised in rabbit using the middle region of Slc22a3 as the immunogen</p>

<p>Park2 antibody was raised in rabbit using the C terminal of Park2 as the immunogen</p>

<p>GLYAT antibody was raised in Rabbit using Human GLYAT as the immunogen</p>

<p>The ERBB3 protein is a glycan that plays a crucial role in various biological processes. It is activated by molecules such as TNF-α and GM-CSF, which are involved in immune responses and cell growth regulation. In the field of Life Sciences, the ERBB3 protein is widely studied due to its importance in signaling pathways and cellular functions.</p>

<p>RELM beta antibody was raised in rabbit using highly pure recombinant murine RELMbeta as the immunogen.</p>

<p>Mouse monoclonal DNAAF1 antibody</p>

<p>Purified recombinant NDUFV2 protein (His tag)</p>

<p>The BIK antibody is a monoclonal antibody that targets the epidermal growth factor receptor (EGFR) pathway. It is commonly used in life sciences research to study EGFR signaling and its role in various cellular processes. The BIK antibody specifically binds to activated EGFR, inhibiting its downstream signaling and preventing cell growth and proliferation. This antibody has also been shown to have anti-CD20 activity, making it a useful tool for studying B-cell biology. Additionally, the BIK antibody can be used in immunohistochemistry and Western blotting techniques to detect the presence of EGFR in tissue samples. Its high specificity and sensitivity make it an excellent choice for researchers studying the role of EGFR in cancer, development, and other biological processes.</p>

<p>Rabbit polyclonal Fibronectin antibody (HRP)</p>

<p>MGP antibody was raised in Rabbit using Human MGP as the immunogen</p>