Bioquímicos e reagentes

<p>RAB2B antibody was raised in rabbit using the C terminal of RAB2B as the immunogen</p>

<p>ALDH18A1 antibody was raised using the N terminal of ALDH18A1 corresponding to a region with amino acids SVIRHVRSWSNIPFITVPLSRTHGKSFAHRSELKHAKRIVVKLGSAVVTR</p>

<p>Rabbit Polyclonal NFkB p105/p50 antibody</p>

<p>NASP antibody was raised in Rabbit using Human NASP as the immunogen</p>

<p>Rabbit Polyclonal JNK antibody (Thr183)</p>

<p>Bovine IgG protein is a purified immunoglobulin derived from bovine serum. It is a high-quality source of antibodies that can be used in various applications within the field of life sciences. Bovine IgG protein has been extensively studied and proven to have excellent binding properties, making it an ideal choice for research purposes. This protein has the ability to specifically bind to target molecules such as interferon, tyrosine, dopamine, and TGF-beta, neutralizing their effects. Additionally, bovine IgG protein has shown to be effective in blocking the activity of certain binding proteins and monoclonal antibodies. With its wide range of applications and superior quality, bovine IgG protein is a valuable tool for scientists and researchers in the field of immunology and beyond.</p>

<p>Purified recombinant Mouse Lgals2 protein (His tag)</p>

<p>UBE2E3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSSDRQRSDDESPSTSSGSSDADQRDPAAPEPEEQEERKPSATQQKKNTK</p>

<p>SELE antibody was raised in rabbit using the N terminal of SELE as the immunogen</p>

<p>Mouse monoclonal SNX9 antibody</p>

<p>TCTA antibody was raised using the middle region of TCTA corresponding to a region with amino acids IQLAWGFYGNTVTGLYHRPGLGGQNGSTPDGSTHFPSWEMAANEPLKTHR</p>

<p>Rabbit polyclonal CCDC45 antibody</p>

<p>The CCL2 antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that specifically targets and detects delta-9-tetrahydrocannabinol (THC), a key compound found in cannabis. This antibody has been extensively tested and validated for its accuracy and sensitivity in detecting THC in various samples, including human serum.</p>

<p>LAT2 antibody was raised in Rabbit using Human LAT2 as the immunogen</p>

<p>CA 19-9 protein is a collagen-based electrode nanocomposite that is used in the field of glycation research. It has been shown to have high affinity for alpha-fetoprotein (AFP) and can be used as a neutralizing agent for TNF-α. CA 19-9 protein is widely used in life sciences research, particularly in the study of protein-protein interactions and signal transduction pathways. It has also been investigated as a potential family kinase inhibitor and has been shown to disrupt actin filaments when combined with phalloidin. Additionally, CA 19-9 protein has been explored for its potential role in creatine metabolism and its interaction with TGF-beta signaling pathways.</p>

<p>DHX29 antibody was raised in mouse using recombinant Human Deah (Asp-Glu-Ala-His) Box Polypeptide 29 (Dhx29)</p>

<p>The PPM1G antibody is a highly effective medicament that has been extensively studied in various scientific fields, including hybridization and human hepatocytes. This antibody specifically targets pancreatic elastase, an enzyme involved in the breakdown of proteins in the pancreas. By inhibiting the activity of pancreatic elastase, this antibody can prevent cytotoxic effects and promote overall health.</p>

<p>Rabbit polyclonal APC1 antibody (Ser355)</p>

<p>Rabbit polyclonal MAPKAPK5 antibody</p>

<p>Amyloid beta-protein (Aβ) is a peptide that is associated with Alzheimer's disease. It is a research tool for understanding the biology of Aβ. The Aβ peptide has been shown to activate a number of receptors and ion channels, including the nicotinic acetylcholine receptor, which may be due to its ability to bind to these proteins with high affinity. Amyloid beta-protein has also been shown to bind antibodies, which may be due to its ability to act as an antigen. Amyloid beta-protein inhibits the function of ion channels and can be used in pharmacological studies as a tool for understanding how this protein interacts with other proteins.</p>

<p>The Influenza B antibody is a highly specialized antibody that targets the influenza B virus. It works by neutralizing the virus surface antigen, preventing it from infecting healthy cells. This antibody is classified as a monoclonal antibody, meaning it is produced from a single clone of immune cells. It has been shown to have cytotoxic effects on infected cells and can also activate immune responses such as the production of interleukin-6 and interferon-gamma.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for bactericidal activity. This drug effectively inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Extensive studies have shown its high efficacy in human activity using a patch-clamp technique on human erythrocytes.</p>

<p>CAMK2D antibody was raised in Rabbit using Human CAMK2D as the immunogen</p>

<p>Mouse monoclonal CBWD1 antibody</p>

<p>FZR1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SSPVSSPSKHGDRFIPSRAGANWSVNFHRINENEKSPSQNRKAKDATSDN</p>

<p>Prekallikrein antibody (HRP) was raised in sheep using human active site-blocked Kallikrein prepared from plasma as the immunogen.</p>

<p>2'-Meccpa is a selective adenosine agonist that has been shown to have potential use in the treatment of atrial fibrillation. It selectively binds to the A1 receptor, which is expressed on cardiac tissues and adrenergic receptors, and activates these receptors. This drug also has anti-inflammatory properties, as it inhibits the production of inflammatory mediators such as tumor necrosis factor-α (TNF-α) and nitric oxide (NO). It can also inhibit l-type calcium channels and activate α1-adrenergic receptors. 2'-Meccpa may be used in conjunction with tecadenoson for the treatment of atrial fibrillation.</p>

<p>The XRCC4 antibody is a monoclonal antibody that specifically targets XRCC4, a protein involved in DNA repair. This antibody has been shown to have high affinity and specificity for XRCC4, making it an ideal tool for studying the function and regulation of this protein. It can be used in various applications such as Western blotting, immunoprecipitation, and immunofluorescence. The XRCC4 antibody is widely used in the field of Life Sciences to investigate DNA repair mechanisms and their role in disease development. With its exceptional performance and reliability, this antibody is a valuable asset for researchers in the field.</p>

<p>Goat anti Mouse IgG1 secondary antibody (FITC)</p>

<p>Donkey anti-goat IgG (H + L) (Alk Phos) was raised in donkey using goat IgG (H &amp; L) as the immunogen.</p>

<p>Rabbit polyclonal Hemoglobin antibody (HRP)</p>

<p>1-364 amino acids: MGSSHHHHHH SSGLVPRGSH MPYQYPALTP EQKKELSDIA HRIVAPGKGI LAADESTGSI AKRLQSIGTE NTEENRRFYR QLLLTADDRV NPCIGGVILF HETLYQKADD GRPFPQVIKS KGGVVGIKVD KGVVPLAGTN GETTTQGLDG LSERCAQYKK DGADFAKWRC VLKIGEHTPS ALAIMENANV LARYASICQQ NGIVPIVEPE ILPDGDHDLK RCQYVTEKVL AAVYKALSDH HIYLEGTLLK PNMVTPGHAC TQKFSHEEIA MATVTALRRT VPPAVTGITF LSGGQSEEEA SINLNAINKC PLLKPWALTF SYGRALQASA LKAWGGKKEN LKAAQEEYVK RALANSLACQ GKYTPSGQAG AAASESLFVS NHAY</p>

<p>Purified Polyclonal Serpin B9 antibody</p>

<p>Canine Serum is a high-quality biospecimen that is commonly used in veterinary applications. It is derived from the blood of canines and contains a variety of important components such as antibodies, cytokines, and enzymes. Canine Serum has a moderate viscosity, which allows for easy handling and processing in laboratory settings.</p>

<p>CD106 antibody was raised in rat using murine CD106/VCAM-1 as the immunogen.</p>

<p>Rabbit polyclonal NPKL13 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PLA2G4E antibody, catalog no. 70R-4051</p>

<p>Glycoprotein antibody was raised using a synthetic peptide corresponding to a region with amino acids KGGRVQAVLTSDSPALVGSNITFAVNLIFPRCQKEDANGNIVYEKNCRNE</p>

<p>Mouse IgG2a heavy chain antibody (biotin) was raised in rat using murine IgG as the immunogen.</p>

<p>Purified Polyclonal PSD93 antibody</p>

<p>Kallikrein 2 Monoclonal Antibody</p>

<p>Purified Polyclonal CLK2 antibody</p>

<p>ELAVL2 antibody was raised using the N terminal of ELAVL2 corresponding to a region with amino acids METQLSNGPTCNNTANGPTTINNNCSSPVDSGNTEDSKTNLIVNYLPQNM</p>

<p>The NF200 antibody is a highly specialized monoclonal antibody that targets and binds to the NF200 protein. This protein is found in human serum and plays a crucial role in growth factor signaling pathways. The NF200 antibody can be used as a test compound in various research studies to investigate its cytotoxic effects on specific cell types.</p>

<p>Purified recombinant GNB1 protein (His tag)</p>

<p>The p53 antibody is a highly specific polyclonal antibody that targets the tumor suppressor protein p53. This protein plays a crucial role in regulating cell growth and preventing the formation of cancerous cells. The p53 antibody is commonly used in life sciences research to study the expression and function of p53 in various biological samples.</p>

<p>Rabbit polyclonal PP2A antibody (HRP)</p>

<p>Elk1 antibody is a highly specific antibody that targets the Elk1 protein, which is a transcription factor involved in steroid hormone signaling. This antibody has been extensively tested and validated for use in various applications, including Western blotting, immunohistochemistry, and immunofluorescence. It has been shown to exhibit high affinity and specificity for Elk1, making it an excellent tool for studying the role of this protein in cellular processes.</p>

<p>Calpain 2 antibody was raised in mouse using purified bovine skeletal muscle 80 kDa subunit of m-calpain as the immunogen.</p>

<p>The CD80 antibody is a highly effective and versatile tool in the field of Life Sciences. This monoclonal antibody has a colloidal structure that allows it to efficiently bind to collagen and other target molecules. It is commonly used in research and diagnostic applications, particularly in the study of TGF-beta signaling pathways.</p>