Bioquímicos e reagentes

<p>Mouse monoclonal IgM antibody (FITC)</p>

<p>ME3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGPARPVPLKKRGYDVTRNPHLNKGMAFTLEERLQLGIHGLIPPCFLSQD</p>

<p>Purified recombinant SYT5 protein (His tag)</p>

<p>CRTAP antibody was raised using the N terminal of CRTAP corresponding to a region with amino acids RLFGGLLRRAHCLKRCKQGLPAFRQSQPSREVLADFQRREPYKFLQFAYF</p>

<p>Rabbit polyclonal UBXN4 antibody</p>

<p>Rabbit polyclonal PPP1R11 antibody</p>

<p>Mouse monoclonal PSMC3 antibody</p>

<p>The HP antibody is a cytotoxic monoclonal antibody that acts as a growth factor inhibitor. It is designed to target specific receptors and block their activity, preventing the growth and proliferation of cells. The HP antibody has been shown to be effective in inhibiting the activity of tyrosine kinase inhibitors such as imatinib. It also has neutralizing properties against extracellular histones, which can contribute to inflammation and tissue damage. This antibody is widely used in the field of Life Sciences for research purposes, particularly in studies involving phosphatases and other signaling pathways. With its potent inhibitory effects and specificity, the HP antibody offers great potential for therapeutic applications in various disease conditions.</p>

<p>ACAA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGD</p>

<p>Rabbit polyclonal RNF168 antibody</p>

<p>The Chk2 antibody is a highly effective monoclonal antibody used in Life Sciences research. It specifically targets the Mertk protein, an important regulator of cellular processes such as interferon signaling and β-catenin pathway activation. This antibody has been extensively tested and validated for its high specificity and sensitivity in various applications, including Western blotting, immunofluorescence, and immunohistochemistry.</p>

<p>Rabbit polyclonal JNK1/2/3 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its efficacy has been demonstrated through extensive research using a patch-clamp technique on human erythrocytes. The metabolic transformations of this drug include hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and effectively inhibits their growth in culture.</p>

<p>Mouse thymocyte antibody was raised in rabbit using RBC-free Mouse thymocytes as the immunogen.</p>

<p>E.coli-derived,-17.2 kDa-Recombinant-Murine IL-2.</p>

<p>Rabbit polyclonal TYMS antibody</p>

<p>EVI2A antibody was raised in rabbit using the C terminal of EVI2A as the immunogen</p>

<p>GSR antibody was raised using the N terminal of GSR corresponding to a region with amino acids PTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELP</p>

<p>The CDKN1B antibody is a monoclonal antibody that specifically targets the cyclin-dependent kinase inhibitor 1B (CDKN1B). CDKN1B is a protein that plays a crucial role in cell cycle regulation and acts as a tumor suppressor. This antibody binds to CDKN1B and inhibits its function, leading to uncontrolled cell growth and proliferation.</p>

<p>HNRNPR antibody was raised in Rabbit using Human HNRNPR as the immunogen</p>

<p>The GFAP antibody is a highly specialized polyclonal antibody that is used in Life Sciences research. It is designed to target and neutralize autoantibodies against glial fibrillary acidic protein (GFAP), which is an important marker for astrocytes in the central nervous system. This antibody can be used in various applications, such as immunohistochemistry, Western blotting, and ELISA assays.</p>

<p>Rabbit polyclonal TMC1 antibody</p>

<p>Mouse monoclonal PDXK antibody</p>

<p>TRIM45 antibody was raised using the middle region of TRIM45 corresponding to a region with amino acids EVDPAKCVLQGEDLHRAREKQTASFTLLCKDAAGEIMGRGGDNVQVAVVP</p>

<p>VSIG1 antibody was raised using the N terminal of VSIG1 corresponding to a region with amino acids SIYFSQGGQAVAIGQFKDRITGSNDPGNASITISHMQPADSGIYICDVNN</p>

<p>GTF2A2 antibody was raised in Rabbit using Human GTF2A2 as the immunogen</p>

<p>Rabbit polyclonal CDON antibody</p>

<p>The p53 antibody is a highly specialized product in the field of Life Sciences. It is designed to target and bind to the p53 protein, which plays a crucial role in regulating cell growth and preventing tumor formation. This antibody is commonly used in research laboratories and medical institutions for various applications.</p>

<p>Purified recombinant CDH11 protein (His tag)</p>

<p>Mouse monoclonal TGF beta antibody (biotin)</p>

<p>The KEAP1 antibody is a highly specialized monoclonal antibody that targets KEAP1, a protein involved in the regulation of cellular responses to oxidative stress. This antibody has been extensively studied for its potential therapeutic applications in various diseases, including cancer and neurodegenerative disorders.</p>

<p>Rabbit polyclonal ERK3 antibody</p>

<p>RBM14 antibody was raised in rabbit using the N terminal of RBM14 as the immunogen</p>

<p>ORC6L antibody was raised using a synthetic peptide corresponding to a region with amino acids VEAPAKEMEKVEEMPHKPQKDEDLTQDYEEWKRKILENAASAQKATAE</p>

<p>EphA2 antibody was raised in mouse using recombinant human EphA2 (559-976aa) purified from E. coli as the immunogen.</p>

<p>Rabbit polyclonal CXCL5 antibody (HRP)</p>

<p>Mouse monoclonal PARP16 antibody</p>

<p>The STEAP2 antibody is a polyclonal antibody used in the field of life sciences. It is specifically designed to target and bind to the low-density lipoprotein receptor-related protein 1 (LRP1), which plays a crucial role in regulating cell growth and survival. The STEAP2 antibody has been extensively studied and shown to inhibit the binding of growth factors to LRP1, thereby blocking their signaling pathways.</p>

<p>The AFP antibody is a monoclonal antibody that specifically targets alpha-fetoprotein (AFP), a protein that is produced during fetal development and in certain cancers. This antibody has been shown to inhibit the growth of endothelial cells, which play a crucial role in tumor angiogenesis. Additionally, the AFP antibody has been used in research studies to investigate the potential therapeutic effects of targeting keratinocyte growth factor (KGF) signaling pathways. It has also demonstrated neutralizing activity against other growth factors, such as VEGF and circumsporozoite protein. The AFP antibody may have potential applications in the field of life sciences and could be a valuable tool for researchers studying cancer biology and developing targeted therapies.</p>

<p>Mouse monoclonal CAPZA1 antibody</p>

<p>PCDH8 antibody was raised using the middle region of PCDH8 corresponding to a region with amino acids GATSLVPEGAARESLVALVSTSDRDSGANGQVRCALYGHEHFRLQPAYAG</p>

<p>Rabbit polyclonal SYNJ2BP antibody</p>

<p>RGS8 antibody was raised in rabbit using human RGS8 protein as the immunogen.</p>

<p>HCCA2 antibody was raised in mouse using recombinant Human Hcca2 Protein</p>

<p>Purified recombinant Human GPT2 protein (His tag)</p>

<p>IL1b antibody (biotin) was raised in goat using E. Coli derived recombinant human IL1 beta/IL1F2 as the immunogen.</p>

<p>The LPAR1 antibody is a monoclonal antibody that targets the Lysophosphatidic Acid Receptor 1 (LPAR1). It plays a crucial role in various cellular processes, including cell growth, migration, and survival. This antibody has been extensively studied in the field of life sciences and has shown promising results.</p>

<p>Rabbit polyclonal PUB11 antibody</p>

<p>Human Thyroglobulin (Tg) is a large glycoprotein produced by the thyroid gland, serving as a precursor for the production of thyroid hormones, thyroxine (T₄) and triiodothyronine (T₃). It is synthesized and stored in the thyroid follicular cells, where it plays a crucial role in hormone synthesis by binding iodine and undergoing enzymatic processing to release active thyroid hormones into the bloodstream.</p>

<p>Human phosphopeptide (Ser876) immunogen; rabbit polyclonal PKD2 antibody (Ser876)</p>