Bioquímicos e reagentes
Os bioquímicos e reagentes são substâncias fundamentais para a pesquisa e desenvolvimento em campos como biotecnologia, biologia molecular, farmacologia e medicina. Esses produtos são essenciais para uma variedade de aplicações, incluindo a síntese de compostos, a análise de amostras biológicas, a pesquisa de processos metabólicos e a produção de medicamentos. Na CymitQuimica, oferecemos uma ampla seleção de bioquímicos e reagentes de alta qualidade e pureza, adequados para diversas necessidades científicas e industriais. Nosso catálogo inclui enzimas, anticorpos, ácidos nucleicos, aminoácidos e muitos outros produtos, todos projetados para apoiar pesquisadores e profissionais em seus projetos de pesquisa e desenvolvimento, garantindo resultados confiáveis e reproduzíveis.
Subcategorias de "Bioquímicos e reagentes"
- Biomoléculas(99.127 produtos)
- Por Alvo Biológico(99.160 produtos)
- Por uso/Efeitos Farmacológicos(6.787 produtos)
- Compostos relacionados à criopreservação e aos crioconservantes(21 produtos)
- Desinfetantes, aditivos para aquecimento de líquidos de banho e compostos relacionados(28 produtos)
- Hormónios(346 produtos)
- Biologia Vegetal(6.742 produtos)
- Metabólitos secundários(14.222 produtos)
Foram encontrados 130581 produtos de "Bioquímicos e reagentes"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
B3galnt1 antibody
<p>B3galnt1 antibody was raised in rabbit using the C terminal of B3galnt1 as the immunogen</p>Pureza:Min. 95%SNRP70 antibody
<p>SNRP70 antibody was raised using a synthetic peptide corresponding to a region with amino acids RERERKEELRGGGGDMAEPSEAGDAPPDDGPPGELGPDGPDGPEEKGRDR</p>GFAP antibody
<p>The GFAP antibody is a neutralizing monoclonal antibody that targets the glial fibrillary acidic protein (GFAP). GFAP is an intermediate filament protein found in astrocytes, a type of glial cell in the central nervous system. This antibody has been extensively studied in Life Sciences and has shown promising results in various applications.</p>SCAP antibody
<p>The SCAP antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that can be used for immobilization on electrodes, making it ideal for various research applications. This antibody specifically targets and binds to SCAP (Sterol Regulatory Element-Binding Protein Cleavage-Activating Protein), which plays a crucial role in cholesterol metabolism and lipid homeostasis. By targeting SCAP, researchers can gain valuable insights into the regulation of these processes.</p>Legionella pneumophila protein
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for bactericidal activity. Through its unique mechanism of action, this drug binds to DNA-dependent RNA polymerase, preventing transcription and replication, thereby inhibiting bacterial growth.</p>Pureza:Min. 95%CD11c antibody
<p>The CD11c antibody is a monoclonal antibody that specifically targets the CD11c protein. This protein is involved in various biological processes, including immune response and cell adhesion. The CD11c antibody has been extensively studied for its potential applications in the field of Life Sciences.</p>PODXL antibody
<p>The PODXL antibody is a highly specialized monoclonal antibody that targets the glycoprotein known as podocalyxin-like protein (PODXL). This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications.</p>MYD88 antibody
<p>The MYD88 antibody is a growth factor that is commonly used in immunoassays. It plays a crucial role in various cellular processes, including the activation of mitogen-activated protein kinases and endonucleases. The MYD88 antibody specifically targets the p38 mitogen-activated protein kinase (MAPK) pathway, which is involved in immune responses and inflammation. By immobilizing and activating this pathway, the MYD88 antibody enhances the polymerase activity and caspase-9 activation, leading to increased cell proliferation and apoptosis. This antibody is available as both polyclonal antibodies and monoclonal antibodies, allowing for versatile applications in research and diagnostics. Additionally, the MYD88 antibody has been shown to interact with nuclear factor kappa-light-chain-enhancer (NF-κB), further contributing to its immunomodulatory properties.</p>CD45RO antibody
<p>The CD45RO antibody is a monoclonal antibody that specifically targets the CD45RO protein, which is expressed on activated T cells and memory T cells. This antibody has been extensively studied in the field of Life Sciences and has shown inhibitory effects on interleukin-6 (IL-6) signaling pathway and p38 MAPK activation. It has also been shown to inhibit syncytia formation, a process involved in viral infection.</p>LPL antibody
<p>The LPL antibody is a highly specialized monoclonal antibody that targets and inhibits the activity of lipoprotein lipase (LPL), an enzyme involved in lipid metabolism. This antibody has been extensively studied for its potential therapeutic applications in various fields, including life sciences and ophthalmic formulations.</p>Lactoferrin antibody
<p>The Lactoferrin antibody is a drug antibody that specifically targets the target molecule, Lactoferrin. It is a disulfide bond-containing antibody that has been shown to have high affinity and specificity for Lactoferrin. This antibody can be used in various applications in Life Sciences, such as research, diagnostics, and therapeutics. It has been extensively studied and validated for its ability to detect Lactoferrin in human serum samples using techniques like electrode-based immunoassays. The Lactoferrin antibody can also be used in immunohistochemistry and flow cytometry experiments to study the expression of Lactoferrin in different tissues and cell types. Its versatility and reliability make it an essential tool for researchers working on understanding the role of Lactoferrin in various biological processes.</p>Goat anti Human κ chain (biotin)
<p>This antibody reacts with kappa light chains on human immunoglobulins.</p>Pureza:Min. 95%KRT8 antibody
<p>The KRT8 antibody is a monoclonal antibody that specifically targets Keratin 8 (KRT8), a protein found in epithelial tissues. This antibody has been extensively studied and has shown promising results in various fields of research, particularly in the life sciences.</p>CTNNB1 antibody
<p>The CTNNB1 antibody is a highly potent monoclonal antibody that has shown promising results in the field of Life Sciences. It acts as an active agent by specifically targeting and binding to the CTNNB1 receptor, leading to cell lysis and inhibiting its signaling pathway. This antibody has been extensively studied for its ability to inhibit the growth of cancer cells and has shown potent antitumor activity in various preclinical models.</p>TYRO3 antibody
<p>TYRO3 antibody was raised in Mouse using a purified recombinant fragment of Tyro3 (aa138-321) expressed in E. coli as the immunogen.</p>ETNK2 antibody
<p>The ETNK2 antibody is a neuroprotective monoclonal antibody that has shown promising results in various studies. It has been found to promote the growth and survival of neurons and protect them from damage. This antibody specifically targets ETNK2, a protein involved in neuronal development and function.</p>PNPT1 antibody
<p>PNPT1 antibody was raised using the middle region of PNPT1 corresponding to a region with amino acids CGGSLALMDSGVPISSAVAGVAIGLVTKTDPEKGEIEDYRLLTDILGIED</p>SMAD3 antibody
<p>The SMAD3 antibody is a powerful tool in the field of molecular biology and immunology. It is a polyclonal antibody that specifically targets the SMAD3 protein, which plays a crucial role in various cellular processes such as chemokine signaling, multidrug resistance, and growth factor regulation. This antibody binds to the SMAD3 protein with high affinity and specificity, allowing researchers to study its function and interactions in different experimental settings.</p>TSP1 antibody
<p>The TSP1 antibody is a powerful tool used in Life Sciences. It is an antibody that specifically targets and binds to fibrinogen, a glycoprotein involved in blood clotting. This polyclonal antibody can be used in various applications, such as immunohistochemistry and Western blotting, to detect and quantify the presence of fibrinogen in biological samples. Additionally, the TSP1 antibody has been shown to have cytotoxic effects on cells expressing TNF-related apoptosis-inducing ligand (TRAIL), making it a valuable tool for studying cell death pathways. This monoclonal antibody has also been used in combination with other inhibitors, such as adalimumab, to block the activity of TNF-α, a key mediator of inflammation. With its high specificity and versatility, the TSP1 antibody is an essential component for any researcher working in the field of Life Sciences.</p>FBXO10 antibody
<p>FBXO10 antibody was raised using the middle region of FBXO10 corresponding to a region with amino acids SSSPKPGSKAGSQEAEVGSDGERVAQTPDSSDGGLSPSGEDEDEDQLMYR</p>NAT12 antibody
<p>NAT12 antibody was raised using the middle region of NAT12 corresponding to a region with amino acids EQVRLLSSSLTADCSLRSPSGREVEPGEDRTIRYVRYESELQMPDIMRLI</p>ZNF546 antibody
<p>ZNF546 antibody was raised in rabbit using the N terminal of ZNF546 as the immunogen</p>Pureza:Min. 95%Kcnip3 antibody
<p>Kcnip3 antibody was raised in rabbit using the middle region of Kcnip3 as the immunogen</p>Pureza:Min. 95%PGM1 protein
<p>PGM1 protein is an EGF-like protein that exhibits growth factor activity. It has been shown to promote the growth and differentiation of hepatocyte-like cells. Monoclonal antibodies specific to PGM1 have been developed and can be used for various applications, including hybridization assays and radionuclide imaging. These antibodies have neutralizing properties, which means they can inhibit the biological activity of PGM1. In addition, PGM1 has been found to have a stimulatory effect on TGF-beta signaling pathway and collagen production in liver microsomes. Overall, PGM1 protein plays a crucial role in cellular growth and tissue development.</p>Pureza:Min. 95%CDKN1B antibody
<p>CDKN1B antibody was raised in Mouse using a purified recombinant fragment of human CDKN1B expressed in E. coli as the immunogen.</p>SLC25A21 antibody
<p>SLC25A21 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLSGTIASVINIPFDVAKSRIQGPQPVPGEIKYRTCFKTMATVYQEEGIL</p>Pureza:Min. 95%Phenylbutazone antibody
<p>Phenylbutazone antibody is a polyclonal antibody that specifically targets and binds to phenylbutazone, a nonsteroidal anti-inflammatory drug (NSAID). This antibody has been extensively tested for its inhibition concentration against other NSAIDs such as ibuprofen, aminopyrine, piroxicam, and indomethacin. It is widely used in the field of Life Sciences for research purposes. The structural formula of phenylbutazone is available upon request. Phenylbutazone antibody is a valuable tool for studying the pharmacokinetics and pharmacodynamics of this drug and its interactions with other compounds. With its high specificity and sensitivity, this antibody ensures accurate and reliable results in various immunoassays.</p>Pureza:Min. 95%
