Bioquímicos e reagentes

<p>Rabbit polyclonal Rhombotin 1 antibody (HRP)</p>

<p>WIF1 antibody was raised in Mouse using a purified recombinant fragment of human WIF1 expressed in E. coli as the immunogen.</p>

<p>PSA antibody was raised in mouse using highly pure human Free PSA as the immunogen.</p>

<p>Rabbit polyclonal WRKY65 antibody</p>

<p>Digoxin antibody was raised in mouse using digoxin-BSA as the immunogen.</p>

<p>The Mitochondria antibody is a monoclonal antibody that has neutralizing properties against interferon. It acts by inhibiting the activity of protein kinases and 3-kinase, which are involved in cellular processes such as acetylation and phosphorylation. The antibody is produced through hybridoma cell technology using cellulose as a substrate. It has been shown to react with taxol, a chemotherapy drug used in the treatment of various types of cancer. The Mitochondria antibody is widely used in the field of Life Sciences for research purposes and has proven to be highly effective in studies involving activated cells.</p>

<p>Sheep polyclonal Nitrazepam antibody</p>

<p>Rabbit polyclonal Chl71 antibody</p>

<p>PACRG antibody was raised using the middle region of PACRG corresponding to a region with amino acids GAIMARCNLDHLGSSDPPTSASQVAEIIVNSGDGIDYSQQKRENIGDLIQ</p>

<p>IDH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MMTSVLVCPDGKTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRG</p>

<p>Antithrombin III protein is a crucial component in the field of Life Sciences. It belongs to the group of Proteins and Antigens and is known for its anticoagulant properties. This protein acts as a natural inhibitor of activated clotting factors, thereby preventing excessive blood clot formation. Antithrombin III protein can be used as a therapeutic agent in various medical conditions, such as deep vein thrombosis, pulmonary embolism, and disseminated intravascular coagulation.</p>

<p>Diluent buffer/blocker for use in Poly-HRP enhanced enzymatic labelling of antibodies and antigens. Not biotin-free.</p>

<p>Alpha 2 macroglobulin antibody was raised in goat using human alpha2-macroglobulin as the immunogen.</p>

<p>ADRM1 antibody was raised in rabbit using the C terminal of ADRM1 as the immunogen</p>

<p>MBD4 antibody was raised in Rabbit using Human MBD4 as the immunogen</p>

<p>TPX2 antibody was raised in mouse using recombinant Human Tpx2, Microtubule-Associated, Homolog (Xenopus Laevis) (Tpx2)</p>

<p>Purified Rabbit polyclonal LAT antibody (Tyr171)</p>

<p>Purified recombinant COMMD7 protein (His tag)</p>

<p>Purified native Human TBG protein</p>

<p>Purified recombinant STBD1 protein (His tag)</p>

<p>Purified recombinant CFB protein (His tag)</p>

<p>20-399 amino acids: MRGSHHHHHH GMASMTGGQQ MGRDLYDDDD KDRWGSMEEG LNFPTYDGKD RVVSLSEKNF KQVLKKYDLL CLYYHEPVSS DKVTQKQFQL KEIVLELVAQ VLEHKAIGFV MVDAKKEAKL AKKLGFDEEG SLYILKGDRT IEFDGEFAAD VLVEFLLDLI EDPVEIISSK LEVQAFERIE DYIKLIGFFK SEDSEYYKAF EEAAEHFQPY IKFFATFDKG VAKKLSLKMN EVDFYEPFMD EPIAIPNKPY TEEELVEFVK EHQRPTLRRL RPEEMFETWE DDLNGIHIVA FAEKSDPDGY EFLEILKQVA RDNTDNPDLS ILWIDPDDFP LLVAYWEKTF KIDLFRPQIG VVNVTDADSV WMEIPDDDDL PTAEELEDWI EDVLSGKINT EDDDEDDDDD DNSDEEDNDD SDDDDDE</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections. This active compound exhibits bactericidal activity by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Through various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation, it is metabolized in the body. Rifapentine specifically targets markers expressed by Mycobacterium tuberculosis strains and inhibits their growth. With its proven efficacy and multiple mechanisms of action, this drug offers a promising solution for combating tuberculosis.</p>

<p>This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.</p>

<p>TMEM16A antibody was raised using the middle region of TMEM16A corresponding to a region with amino acids HGFVNHTLSSFNVSDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSENKY</p>

<p>The HDAC3 antibody is a highly specialized monoclonal antibody that acts as a neutralizing agent against the activity of histone deacetylase 3 (HDAC3). It plays a crucial role in regulating gene expression by modifying chromatin structure. The HDAC3 antibody specifically targets and inhibits the enzymatic activity of HDAC3, preventing it from removing acetyl groups from histone proteins. This inhibition leads to increased histone acetylation, resulting in altered gene expression patterns.</p>

<p>Purified Polyclonal OTF3 antibody</p>

<p>The NT5C1A antibody is a polyclonal antibody used in life sciences research. It is specifically designed to target and bind to the NT5C1A protein, which plays a crucial role in various cellular processes. This antibody can be used in experiments involving anti-HER2 antibody, monoclonal antibodies, growth factors, and reaction solutions. Furthermore, it has been shown to have antiangiogenic properties and can inhibit the activity of vascular endothelial growth factor (VEGF), a key regulator of angiogenesis. Additionally, the NT5C1A antibody has been found to be effective in blocking the activation of cardiomyocytes and autoantibodies involved in certain diseases. With its high specificity and reliability, this antibody is an invaluable tool for researchers studying cellular signaling pathways and developing therapeutic interventions.</p>

<p>Mouse monoclonal KCNAB1 antibody</p>

<p>Purified Polyclonal NF kappaB p105 antibody</p>

<p>Rabbit Polyclonal ELOVL5 antibody</p>

<p>Mouse monoclonal SulT1A1 antibody</p>

<p>The TRIM24 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the growth hormone receptor and has been shown to inhibit the activity of this receptor. The TRIM24 antibody is commonly used in studies investigating the role of growth factors, such as trastuzumab, and their interaction with receptors. Additionally, it has been used to study the function of phosphatases and their involvement in cellular signaling pathways. This antibody can be used in various applications, including Western blotting, immunohistochemistry, and flow cytometry. With its high specificity and sensitivity, the TRIM24 antibody is an invaluable tool for researchers studying cell growth and signaling processes.</p>

<p>Rabbit polyclonal MAP2K7 antibody</p>

<p>SIGLEC6 antibody was raised using the N terminal of SIGLEC6 corresponding to a region with amino acids MQGAQEASASEMLPLLLPLLWAGALAQERRFQLEGPESLTVQEGLCVLVP</p>

<p>OR2AT4 antibody was raised using the N terminal of OR2AT4 corresponding to a region with amino acids MDATACNESVDGSPVFYLLGIPSLPETFFLPVFFIFLLFYLLILMGNALI</p>

<p>Mouse monoclonal LIPG antibody</p>

<p>The PRDX3 antibody is a highly specialized product in the field of Life Sciences. It is widely used in various chromatographic techniques and bioassays. This antibody specifically targets nuclear β-catenin, a protein that plays a crucial role in cell signaling and gene expression. The PRDX3 antibody is commonly employed in immunoassays to detect and quantify the levels of β-catenin in biological samples.</p>

<p>IFIH1 antibody was raised in Rabbit using Human IFIH1 as the immunogen</p>

<p>HAAO antibody was raised in Rabbit using Human HAAO as the immunogen</p>

<p>The DCC antibody is a powerful tool for researchers studying kinase signaling pathways. It specifically targets the kinase kinase of the mitogen-activated protein (MAP) kinase pathway, making it an essential component in understanding cellular responses to growth factors and other stimuli. The DCC antibody is available as both monoclonal and polyclonal antibodies, allowing researchers to choose the best option for their specific experiments.</p>

<p>Bovine Red Blood Cells are a vital component in the field of Life Sciences and have various applications, especially in Veterinary Applications. These cells can be used as a fluorophore for imaging studies and other research purposes. The emission properties of Bovine Red Blood Cells make them suitable for use in fluorescence-based assays.</p>

<p>High affinity probe for glucose transporter; photoaffinity label</p>

<p>Rabbit polyclonal LEF1 antibody (Ser42)</p>

<p>Purified recombinant NXPH1 protein (His tag)</p>

<p>HNRNPC antibody was raised in Rabbit using Human HNRNPC as the immunogen</p>

<p>G6PC antibody was raised using the N terminal of G6PC corresponding to a region with amino acids NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM</p>

<p>CLAN antibody was raised in rabbit using N terminus sequence MNFIKDNSRA LIQRMGM of the A and B isoforms of the human CLAN protein as the immunogen.</p>

<p>Il6 protein is an inhibitory factor that belongs to the group of proteins and antigens. It can be used in combination with adalimumab or other inhibitors for therapeutic purposes. Il6 protein has been shown to have chemokine and epidermal growth factor properties, as well as anti-VEGF (vascular endothelial growth factor) and neutralizing effects on TNF-α (tumor necrosis factor-alpha). It also exhibits activity against interleukins and interferons. Additionally, Il6 protein has carbonic properties and can be used in conjugated proteins for various applications, including the treatment of endothelial growth disorders.</p>

<p>Purified Polyclonal EDG3 antibody</p>