Bioquímicos e reagentes

<p>RC3H2 antibody was raised using the middle region of RC3H2 corresponding to a region with amino acids YSRKGHETPQPQPNSKYKTSMCRDLRQQGGCPRGTNCTFAHSQEELEKYR</p>

<p>ALS2CR12 antibody was raised using a synthetic peptide corresponding to a region with amino acids SSKLTPLVPAPKNHNYLQPTKPVVSPKMKIHSARQEETNKSFYEVINVSP</p>

<p>Mouse monoclonal DNTTIP1 antibody</p>

<p>VU 0361737 is a small molecule that has been shown to have anti-inflammatory properties. It binds to glutamate receptors, which are involved in the regulation of inflammatory responses and pain. VU 0361737 also blocks microglia activation, prevents glutamate toxicity, and inhibits tumor progression in a mouse model of melanoma. It was also found to be neuroprotective against glutamate-induced neurotoxicity in primary hippocampal neurons and cerebellar granule cells. The molecular mode of action of VU 0361737 is not completely understood, but it may be due to its ability to block the adenosine receptor A2A signaling pathway.</p>

<p>Rabbit polyclonal XPNPEP3 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is specifically designed to target tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, thereby preventing transcription and replication. Extensive studies have shown its high efficacy in human erythrocytes using a patch-clamp technique.</p>

<p>IL1b antibody is a monoclonal antibody that specifically targets and neutralizes interleukin-1 beta (IL-1β), a pro-inflammatory cytokine involved in various biological processes. IL-1β plays a crucial role in the regulation of immune responses, cell growth, and differentiation. This antibody has been extensively used in research and life sciences to study the function of IL-1β and its inhibitors.</p>

<p>SRD5A2 antibody was raised using the N terminal of SRD5A2 corresponding to a region with amino acids MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPAR</p>

<p>The CDK5 antibody is a highly specialized monoclonal antibody that has neutralizing properties against cyclin-dependent kinase 5 (CDK5). CDK5 is an enzyme involved in various cellular processes, including cell cycle regulation and neuronal development. The CDK5 antibody acts as an inhibitor of CDK5 activity, leading to cytotoxic effects on targeted cells.</p>

<p>HMN-176 is a synthetic antifungal compound, which is an indolocarbazole derivative sourced from a natural alkaloid framework. This product exhibits its mode of action by inhibiting fungal cell division, specifically through interference with microtubule polymerization. This mechanism effectively disrupts the mitotic process, leading to cell cycle arrest and subsequent fungal cell death.</p>

<p>Recombinant Human RPL7A protein</p>

<p>Mouse monoclonal NME4 antibody</p>

<p>The Cytokeratin Antibody Cocktail is a powerful tool for immunohistochemistry and research applications. This cocktail contains a mixture of monoclonal antibodies that specifically target various cytokeratins, which are intermediate filament proteins found in epithelial cells. These monoclonal antibodies have been extensively validated and provide high specificity and sensitivity in detecting cytokeratin expression.</p>

<p>Purified recombinant MDS1 protein (His tag)</p>

<p>Mouse monoclonal Complement D antibody</p>

<p>Rabbit polyclonal ZNF699 antibody</p>

<p>TMTC4 antibody was raised using the N terminal of TMTC4 corresponding to a region with amino acids NKDLQAETPLGDLWHHDFWGSRLSSNTSHKSYRPLTVLTFRINYYLSGGF</p>

<p>Purified recombinant KLF7 protein (His tag)</p>

<p>The TIMM10 antibody is a polyclonal antibody that specifically targets the TIMM10 protein. This protein is located in the mitochondria and plays a crucial role in various cellular processes, including hormone and growth factor signaling, as well as β-catenin stabilization. The TIMM10 antibody binds to the amino-terminal region of the protein, allowing for its detection and analysis in biological samples.</p>

<p>Trazodone Conjugate for use in immunoassays</p>

<p>Mouse monoclonal TOMM34 antibody</p>

<p>Purified recombinant MFAP4 protein (His tag)</p>

<p>PAX6 antibody was raised in Mouse using a purified recombinant fragment of human PAX6 expressed in E. coli as the immunogen.</p>

<p>The MCL1 antibody is a monoclonal antibody that targets the MCL1 protein. This protein is involved in cell survival and has been implicated in various diseases, including cancer. The MCL1 antibody specifically binds to the MCL1 protein, preventing its interaction with other proteins and inhibiting its function. This can lead to decreased cell survival and increased sensitivity to chemotherapy or other treatments. Additionally, the MCL1 antibody has been shown to have anti-inflammatory properties and may play a role in immune regulation. Overall, the MCL1 antibody is a valuable tool for researchers in the field of life sciences and has potential applications in cancer treatment and other therapeutic interventions.</p>

<p>MST1R antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. This medication is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. It works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, thus preventing bacterial growth. The remarkable potency of this drug has been demonstrated through various scientific techniques like the patch-clamp technique on human erythrocytes. Additionally, it undergoes several metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and effectively inhibits their growth in culture</p>

<p>Rabbit polyclonal OR5AU1 antibody</p>

<p>Rat monoclonal CD71 antibody (FITC)</p>

<p>The PDF antibody is a highly specialized molecule drug used in the field of Life Sciences. It is an activated antibody that acts as an anticoagulant, inhibiting the clotting process. This unique antibody has the ability to neutralize various molecules involved in blood coagulation, such as insulin, albumin, and fibrinogen. The PDF antibody is a monoclonal antibody, meaning it is derived from a single clone of cells and exhibits high specificity for its target. In human serum, this antibody has shown remarkable efficacy in inhibiting protein kinase activity, making it a valuable tool for research and therapeutic applications in the field of Life Sciences.</p>

<p>Purified recombinant SLA2 protein (His tag)</p>

<p>Rat monoclonal CD18 antibody (FITC)</p>

<p>Rabbit polyclonal PKCB antibody (Ser661)</p>

<p>RBMS2 antibody was raised using the N terminal of RBMS2 corresponding to a region with amino acids MLLSVTSRPGISTFGYNRNNKKPYVSLAQQMAPPSPSNSTPNSSSGSNGN</p>

<p>Purified Polyclonal MNAT1 antibody</p>

<p>CEA antibody was raised in mouse using human colon adrenocarcinoma as the immunogen.</p>

<p>Mouse monoclonal DNAJA2 antibody</p>

<p>CYP2A6 antibody was raised in rabbit using purified, histidine-tagged, full length human P450 2A6 fusion protein as the immunogen.</p>

<p>Mouse monoclonal SSX2 antibody</p>

<p>Thrombin protein is a versatile molecule that plays a crucial role in blood clotting. It is commonly used in various applications, including DNA aptamer selection, flow assays, polymerase chain reactions (PCR), and immunoassays. Thrombin protein is acidic in nature and can be easily immobilized on streptavidin-coated surfaces for use in Life Sciences research. Its native form allows for accurate detection and measurement of thrombin levels in samples using electrochemical impedance or other techniques.</p>

<p>Purified Polyclonal CK1 epsilon antibody</p>

<p>PDE2A antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Purified Polyclonal MCM4 antibody</p>

<p>DNAJB12 antibody was raised using a synthetic peptide corresponding to a region with amino acids ILILILVSALSQLMVSSPPYSLSPRPSVGHIHRRVTDHLGVVYYVGDTFS</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the class of rifamycins. It is specifically designed to combat tuberculosis infections. With its bactericidal activity, this compound effectively inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its potency has been proven through extensive testing using the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it selectively binds to markers expressed in high levels in Mycobacterium tuberculosis strains, inhibiting their growth in culture.</p>

<p>MSGDDDIPEG LEAINLKMNA TTDDSLESTR RMLALCEESK EAGIKTLVML DDQGEQLERC EGALDTINQD MKEAEDHLKG MEKCCGLCVL PWNKTDDFEK TEFAKAWKKD DDGGVISDQP RITVGDSSMG PQGGYITKIT NDAREDEMDE NVQQVSTMVG NLRNMAIDMS TEVSNQNRQL DRIHDKAQSN EVRVESANKR AKNLITK</p>

<p>OR2J2 antibody was raised in rabbit using the C terminal of OR2J2 as the immunogen</p>

<p>TAB2 antibody was raised in Mouse using a purified recombinant fragment of human TAB2 expressed in E. coli as the immunogen.</p>

<p>Purified Polyclonal ITIH2 antibody</p>

<p>His tag antibody was raised in rabbit using 6-His (HHHHHH) conjugated to KLH as the immunogen.</p>

<p>Ferritin antibody was raised in rabbit using Ferritin [human Spleen] as the immunogen.</p>