Bioquímicos e reagentes
Os bioquímicos e reagentes são substâncias fundamentais para a pesquisa e desenvolvimento em campos como biotecnologia, biologia molecular, farmacologia e medicina. Esses produtos são essenciais para uma variedade de aplicações, incluindo a síntese de compostos, a análise de amostras biológicas, a pesquisa de processos metabólicos e a produção de medicamentos. Na CymitQuimica, oferecemos uma ampla seleção de bioquímicos e reagentes de alta qualidade e pureza, adequados para diversas necessidades científicas e industriais. Nosso catálogo inclui enzimas, anticorpos, ácidos nucleicos, aminoácidos e muitos outros produtos, todos projetados para apoiar pesquisadores e profissionais em seus projetos de pesquisa e desenvolvimento, garantindo resultados confiáveis e reproduzíveis.
Subcategorias de "Bioquímicos e reagentes"
- Biomoléculas(99.117 produtos)
- Por Alvo Biológico(99.161 produtos)
- Por uso/Efeitos Farmacológicos(6.787 produtos)
- Compostos relacionados à criopreservação e aos crioconservantes(21 produtos)
- Desinfetantes, aditivos para aquecimento de líquidos de banho e compostos relacionados(28 produtos)
- Hormónios(346 produtos)
- Biologia Vegetal(6.705 produtos)
- Metabólitos secundários(14.220 produtos)
Foram encontrados 130581 produtos de "Bioquímicos e reagentes"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
KT 5823
CAS:<p>Inhibitor of protein kinase PKG</p>Fórmula:C29H25N3O5Pureza:Min. 95%Cor e Forma:SolidPeso molecular:495.53 g/molLeflunomide-d4
CAS:Produto Controlado<p>Leflunomide-d4 is a potent inhibitor of protein interactions, which has been used as a research tool to study the effects of peptides on ion channels. Leflunomide-d4 binds to peptides and interacts with them in vitro. This inhibition can be reversed by adding a specific ligand that competes with the binding site. Leflunomide-d4 is also an activator of the receptor for angiotensin II, which is involved in the regulation of blood pressure. It has been shown to inhibit the activation of some ion channels, such as those for potassium and calcium ions, although it does not inhibit other ion channels such as those for sodium and chloride ions. The molecular weight of leflunomide-d4 is 806 daltons and its CAS number is 1189987-23-2.</p>Fórmula:C12H9F3N2O2Pureza:Min. 95%Peso molecular:274.23 g/molJNJ-10229570
CAS:<p>JNJ-10229570 is a potent and selective antagonist of the neuropeptide Y Y5 receptor, which is a G-protein-coupled receptor implicated in the regulation of feeding behavior and energy homeostasis. Sourced from advanced pharmaceutical research, this compound functions by competitively inhibiting the binding of neuropeptide Y to its Y5 receptor, thereby modulating physiological processes related to appetite and energy balance.</p>Fórmula:C22H19N3O2SPureza:Min. 95%Peso molecular:389.47 g/molACTL7B antibody
<p>ACTL7B antibody was raised using the middle region of ACTL7B corresponding to a region with amino acids KLITIGQERFRCSEMLFQPSLAGSTQPGLPELTAACLGRCQDTGFKEEMA</p>CDK1 antibody
<p>The CDK1 antibody is a monoclonal antibody that specifically targets and inhibits the activity of cyclin-dependent kinase 1 (CDK1). CDK1 is a protein kinase involved in cell cycle regulation, making it an important target for therapeutic interventions. This antibody has been shown to effectively block the activity of CDK1, thereby preventing cell proliferation and promoting cell death.</p>Goat anti Human IgG (H + L) (HRP)
<p>Goat anti Human IgG (H + L) secondary antibody (HRP)</p>Pureza:Min. 95%Lexibulin dihydrochloride
CAS:<p>Lexibulin dihydrochloride is a research tool for the study of protein interactions. It is an inhibitor of Protein Kinase C (PKC) that has been shown to regulate the activity of ion channels, such as calcium channels and sodium channels. Lexibulin dihydrochloride is a high-purity chemical compound with a CAS number of 917111-49-0.</p>Fórmula:C24H32Cl2N6O2Pureza:Min. 95%Peso molecular:507.5 g/molAcitretin sodium
CAS:<p>Please enquire for more information about Acitretin sodium including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C21H26NaO3Pureza:Min. 95%Peso molecular:349.4 g/molDCG04
CAS:<p>Please enquire for more information about DCG04 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C43H66N8O11SPureza:Min. 95%Peso molecular:903.1 g/molQL47
CAS:<p>QL47 is a molecule that inhibits phosphorylation of protein and translation. It also has anti-inflammatory properties and can be used to treat autoimmune diseases and inflammatory diseases. QL47 binds to the ferroelectric domain in the cell membrane, which is involved in cellular signaling. This binding prevents the formation of a phosphate-protein complex, which inhibits phosphorylation. The inhibition mechanism is due to the hydroxyl group on QL47, which interacts with the hydroxyl group on tyrosine residues in proteins and blocks their access to phosphate groups. QL47 can be detected using mass spectrometry methods and has been shown to have pharmacokinetic properties that are dependent on dose, blood flow rate, and tissue perfusion.</p>Fórmula:C27H21N5O2Pureza:Min. 95%Peso molecular:447.49 g/molDS44170716
CAS:<p>DS44170716 is a mitochondrial-targeted drug that inhibits the mitochondrial permeability transition pore (MPTP) and prevents Ca2+ overload in mitochondria. It is also a membrane-permeable small molecule, which can be taken up by cells and accumulate in mitochondria. DS44170716 may act as an intracellular Ca2+ chelator, preventing reactive cytosolic Ca2+ from entering the mitochondria and thereby inhibiting cellular signaling pathways involved in cell death. DS44170716 has been shown to prevent liver injury induced by ischemia reperfusion in rats.</p>Fórmula:C20H18BrNO2Pureza:Min. 95%Peso molecular:384.3 g/molNimesulide-d5
CAS:<p>Nimesulide-d5 is a 5-fluorinated derivative of nimesulide, which is a nonsteroidal anti-inflammatory drug. Nimesulide-d5 has been shown to have an increased terminal half-life in humans and healthy Chinese subjects, as well as reduced glucuronide conjugate formation. This drug also has an enhanced particle size and improved spectral properties for use in chromatographic applications. Nimesulide-d5 is clinically relevant for the treatment of cancer and acetaminophen induced hepatotoxicity. It is metabolized into its active form by cytochrome P450 enzymes, leading to the inhibition of protein synthesis in cancer cells and the prevention of liver toxicity due to acetaminophen overdose.</p>Fórmula:C13H7D5N2O5SPureza:Min. 95%Peso molecular:313.34 g/molSSB antibody
<p>SSB antibody is a monoclonal antibody that specifically targets the SSB protein. This protein plays a crucial role in various biological processes, including DNA replication and repair. The SSB antibody can be used in research and diagnostic applications to study the function of SSB and its interactions with other proteins.</p>TFG antibody
<p>The TFG antibody is a powerful tool in the field of Life Sciences. It is specifically designed to target and detect cardiomyocytes, making it ideal for studying various aspects of cardiac function. This antibody can be used in multidrug studies, electrophoresis experiments, and polymerase chain reactions to analyze the effects of different substances on cardiomyocyte activity.</p>BSA antibody
<p>BSA antibody was raised in rabbit using bovine albumin as the immunogen.</p>Pureza:Min. 95%FGF21 antibody
<p>The FGF21 antibody is a highly specialized product in the field of Life Sciences. It is an antibody that specifically targets and binds to FGF21, a growth factor involved in various biological processes. This antibody has been extensively studied and characterized for its ability to inhibit the activity of FGF21.</p>UHRF1 antibody
<p>The UHRF1 antibody is a polyclonal antibody that specifically targets the protein UHRF1. UHRF1 plays a crucial role in epigenetic regulation and is involved in various cellular processes, including DNA methylation, chromatin remodeling, and gene expression. This antibody allows for the detection and analysis of UHRF1 levels in different biological samples.</p>PKNOX1 antibody
<p>The PKNOX1 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the PKNOX1 protein, a human protein that plays a crucial role in various cellular processes. This antibody has been extensively characterized and exhibits high specificity and affinity towards PKNOX1.</p>CYM-5442
CAS:<p>CYM-5442 is a colony-stimulating factor that has been shown to have a variety of effects on tissue culture. It has been shown to stimulate the growth of cells in vitro, and may be used for the treatment of autoimmune diseases, cardiac problems, and inflammatory bowel disease. CYM-5442 also acts as an acylation reaction with glucose regulation in the body and can stimulate serotonin reuptake inhibition. This drug is also thought to have activity against bowel diseases such as Crohn's disease, ulcerative colitis, or irritable bowel syndrome by inhibiting toll-like receptor 4 (TLR4).</p>Fórmula:C23H27N3O4Pureza:Min. 95%Peso molecular:409.48 g/molTRPM4 antibody
<p>The TRPM4 antibody is a high-quality monoclonal antibody that specifically targets the TRPM4 protein. This antibody is widely used in life sciences research and has been shown to have excellent specificity and sensitivity. It binds to the carbonyl group of the TRPM4 protein, inhibiting its activity and preventing downstream signaling pathways.</p>TNKS antibody
<p>The TNKS antibody is a highly specialized product in the field of Life Sciences. It is an antibody that specifically targets and neutralizes the activity of tankyrase enzymes. Tankyrases play a crucial role in various cellular processes, including the regulation of Wnt signaling, telomere maintenance, and DNA repair.</p>Y-33075 dihydrochloride
CAS:<p>Y-33075 dihydrochloride is a potent selective Rho-associated kinase (ROCK) inhibitor, which is synthesized chemically. It specifically targets ROCK enzymes involved in the regulation of the cytoskeleton by phosphorylating proteins that control smooth muscle contraction, cell migration, and other critical cellular processes. Y-33075 dihydrochloride works by inhibiting the ROCK pathway, leading to alterations in cell shape, motility, and apoptosis.</p>Fórmula:C16H18Cl2N4OPureza:Min. 95%Peso molecular:353.25 g/molGoat anti Human IgM (Fab'2) (FITC)
<p>Goat anti-human IgM (Fab'2) (FITC) was raised in goat using human IgM Fc5m fragment as the immunogen.</p>Pureza:Min. 95%SC5DL antibody
<p>SC5DL antibody was raised using a synthetic peptide corresponding to a region with amino acids NQVRREIKFTVQALPWISILTVALFLLEIRGYSKLHDDLGEFPYGLFELV</p>Pureza:Min. 95%Ifn α-ifnar-in-1 hydrochloride
CAS:<p>Ifn alpha-ifnar-in-1 hydrochloride is a synthetic small molecule, which is derived from chemical synthesis with a focus on disrupting specific cytokine signaling pathways. This compound operates by selectively inhibiting the interaction between interferon-alpha (IFN-α) and its receptor, IFNAR, thereby blocking downstream JAK-STAT signaling pathways. The blockade of this signaling cascade is crucial in modulating immune responses, which are often dysregulated in various pathologies.</p>Fórmula:C18H18ClNSPureza:Min. 95%Peso molecular:315.86 g/molCX 546
CAS:<p>AMPA receptor potentiator</p>Fórmula:C14H17NO3Pureza:Min. 95%Peso molecular:247.29 g/molSideroflexin 4 antibody
<p>Sideroflexin 4 antibody was raised using the C terminal of SFXN4 corresponding to a region with amino acids SCTVLAMGLMVPFSFSIFPQIGQIQYCSLEEKIQSPTEETEIFYHRGV</p>Pureza:Min. 95%PF-3758309
CAS:<p>PF-3758309 is a small molecule inhibitor, which is identified as a product of synthetic chemical engineering. It acts as a potent inhibitor of the PAK kinases, particularly PAK4, a family of serine/threonine kinases involved in cytoskeletal dynamics, cell motility, survival, and proliferation. These kinases are overexpressed in various types of cancer, making them attractive targets for therapeutic intervention.</p>Fórmula:C25H30N8OSPureza:Min. 95%Peso molecular:490.63 g/molCortactin antibody
<p>Cortactin antibody was raised using the N terminal of CTTN corresponding to a region with amino acids KHCSQVDSVRGFGGKFGVQMDRVDQSAVGFEYQGKTEKHASQKDYSSGFG</p>PSI-697
CAS:<p>PSI-697 is a heparinoid that inhibits the synthesis of thrombin and other coagulation factors. It is an anticoagulant, which prevents the formation of blood clots in the circulatory system. PSI-697 has been shown to be effective against heparin-induced thrombocytopenia, which is due to its ability to inhibit the activation of platelets by the receptor toll-like receptor 4 (TLR4). It also inhibits signaling pathways that are involved in growth factor production. PSI-697 has been studied for its pharmacokinetic properties in humans, and it was found that it had a long half-life and low clearance rate.</p>Fórmula:C21H18ClNO3Pureza:Min. 95%Peso molecular:367.83 g/molTNK1 antibody
<p>TNK1 antibody is a reactive antibody that specifically targets the TNK1 protein. TNK1 is involved in various cellular processes, including the epidermal growth factor (EGF) signaling pathway. This antibody can be used in Life Sciences research to study the role of TNK1 in different biological systems. It has been shown to bind to TNK1 with high specificity and affinity. The TNK1 antibody can also be used as a diagnostic tool for detecting TNK1 levels in patient samples. Additionally, this antibody can be used in immunohistochemistry assays to visualize the localization of TNK1 within tissues. With its ability to recognize and bind to TNK1, this antibody offers researchers a valuable tool for understanding the function of this protein in various cellular processes.</p>Tulopafant
CAS:<p>Tulopafant is a novel linker drug that has shown efficacy in treating ischemia/reperfusion injury. It acts by binding to and activating neutrophils, which are important for the body's immune response to infection. Tulopafant promotes the release of reactive oxygen species from neutrophils, and it also neutralizes reactive nitrogen species. This drug has been shown to be effective in reducing ventricular fibrillation in vitro studies and may be useful as a treatment for myocardial infarcts.</p>Fórmula:C25H19N3O2SPureza:Min. 95%Peso molecular:425.5 g/molRMC-0331
CAS:<p>RMC-0331 is an anticancer protein that has been shown to inhibit the growth of cancer cells in vitro. It is a potent inhibitor of kinase activity and has been found to induce apoptosis in various types of cancer cells, including those from Chinese hamster ovary (CHO) and human tumor cell lines. RMC-0331 is an analog of linezolid, a drug used to treat bacterial infections, and has been shown to have potent anticancer activity in animal models. This drug may be useful for the treatment of various types of cancer and could potentially be used in combination with other kinase inhibitors or chemotherapy agents. RMC-0331 can be detected in urine samples and may serve as a biomarker for monitoring the efficacy of this drug in cancer patients.</p>Fórmula:C22H25ClF3N5O3Pureza:Min. 95%Peso molecular:499.9 g/mol
