Bioquímicos e reagentes

<p>Mouse monoclonal MTFMT antibody</p>

<p>HOMEZ antibody was raised in rabbit using the N terminal of HOMEZ as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GFM2 antibody, catalog no. 70R-10104</p>

<p>1-181 amino acids: MGSSHHHHHH SSGLVPRGSH MESKEPQLKG IVTRLFSQQG YFLQMHPDGT IDGTKDENSD YTLFNLIPVG LRVVAIQGVK ASLYVAMNGE GYLYSSDVFT PECKFKESVF ENYYVIYSST LYRQQESGRA WFLGLNKEGQ IMKGNRVKKT KPSSHFVPKP IEVCMYREQS LHEIGEKQGR SRKSSGTPTM NGGKVVNQDS T</p>

<p>The CD10 antibody is a monoclonal antibody that targets the CD10 protein, which is also known as neutral endopeptidase. This protein plays a crucial role in the degradation of extracellular matrix components such as collagen and acts as a kinase inhibitor. The CD10 antibody has been widely used in Life Sciences research to study various biological processes.</p>

<p>This antibody reacts with heavy (gamma) chains on rat IgG and light chains on all rat immunoglobulins.</p>

<p>The SYNCRIP antibody is a highly specialized antibody used in the field of Life Sciences. It is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific needs. This antibody has been extensively tested and shown to be effective in detecting SYNCRIP proteins in human serum samples.</p>

<p>MFAP4 antibody was raised using the N terminal of MFAP4 corresponding to a region with amino acids TEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQNMHLLTLK</p>

<p>REEP1 antibody was raised using the middle region of REEP1 corresponding to a region with amino acids AKDRSYDALVHFGKRGLNVAATAAVMAASKGQGALSERLRSFSMQDLTTI</p>

<p>The GPR87 antibody is a highly effective polyclonal antibody that specifically targets G-protein coupled receptor 87 (GPR87). This antibody has the ability to neutralize the activity of GPR87, which is known to play a crucial role in various cellular processes. It has been shown to inhibit the epidermal growth factor (EGF) signaling pathway, making it an excellent candidate for therapeutic applications in cancer treatment. Additionally, this antibody has shown promising results as a potential anti-HER2 antibody, further highlighting its versatility and effectiveness. With its ability to bind to interferon-gamma (IFN-gamma) and other growth factors, the GPR87 antibody offers a wide range of applications in the field of life sciences. Whether used as a research tool or for therapeutic purposes, this antibody is a valuable asset for scientists and researchers alike.</p>

<p>Purified Rabbit polyclonal MRPL50 antibody</p>

<p>N-[3-[(2R,3R)-5-Amino-3,6-dihydro-3-methyl-2-(trifluoromethyl)-2H-1,4-oxazin-3-yl]-4-fluorophenyl]-5-cyano-2-pyridinecarboxamide is a high purity chemical compound that is used in research. CAS No. 1352416-78-4 is an antibody that binds to the receptor of the ion channels and can be used as a research tool. The ligand is an inhibitor or activator of the protein interactions. This reagent has been shown to be useful for the study of cell biology and pharmacology.</p>

<p>OXCT1 antibody was raised using the N terminal of OXCT1 corresponding to a region with amino acids TLAERIRAGGAGVPAFYTPTGYGTLVQEGGSPIKYNKDGSVAIASKPREV</p>

<p>Rabbit polyclonal USP34 antibody</p>

<p>RAB27A antibody was raised using the middle region of RAB27A corresponding to a region with amino acids SQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACG</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NKAIN1 antibody, catalog no. 70R-7160</p>

<p>The C1S antibody is a potent monoclonal antibody that belongs to the class of neutralizing antibodies. It is widely used in the field of Life Sciences for various applications. This antibody specifically targets and neutralizes C1S, a protease involved in the complement system. By inhibiting C1S activity, this antibody can modulate immune responses and prevent excessive inflammation. Additionally, this monoclonal antibody has been shown to have mitogenic properties, stimulating cell growth and proliferation in various cell types such as dopamine-producing cells and collagen-producing cells. Furthermore, it has been used in research studies to enhance the oncolytic activity of adenoviruses and inhibit protease activity at low pH levels. The C1S antibody is a valuable tool for researchers studying hepatocyte growth and activation pathways.</p>

<p>Mouse monoclonal KIAA1609 antibody</p>

<p>Mouse monoclonal SPG7 antibody</p>

<p>Rabbit polyclonal LATS2 antibody</p>

<p>Rabbit polyclonal Adiponectin antibody (HRP)</p>

<p>VSV-G antibody was raised in goat using VSV-G (YTDIEMNRLGK) conjugated to KLH as the immunogen.</p>

<p>Purified Polyclonal cJun antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an active compound used as an antituberculosis drug. It belongs to the class of rifamycins and is highly effective in treating tuberculosis infections. This drug works by inhibiting bacterial growth through its bactericidal activity. By binding to DNA-dependent RNA polymerase, it prevents transcription and replication, thus stopping the spread of the infection. Additionally, it specifically targets Mycobacterium tuberculosis strains and inhibits their cell growth. The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside undergoes various metabolic transformations in the body, ensuring its effectiveness against the bacteria.</p>

<p>MRPS22 antibody was raised in Rabbit using Human MRPS22 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KCNK5 antibody, catalog no. 70R-5224</p>

<p>FBXO11 antibody was raised using the middle region of FBXO11 corresponding to a region with amino acids HDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDTDTLYDSAPPIESNTLQ</p>

<p>Purified recombinant STEAP4 protein (His tag)</p>

<p>UCRC antibody was raised using a synthetic peptide corresponding to a region with amino acids LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RAB23 antibody, catalog no. 70R-5787</p>

<p>CD5 antibody (PE) was raised in mouse using human CD5 as the immunogen.</p>

<p>The SOCS3 antibody is a powerful tool in the field of Life Sciences. It belongs to the category of Monoclonal Antibodies and is specifically designed to target and bind to the suppressor of cytokine signaling 3 (SOCS3) protein. This antibody has been extensively tested and validated for use in various applications, including immunohistochemistry, Western blotting, and ELISA.</p>

<p>Cystatin C antibody is a highly specialized product used in the field of Life Sciences. It is a microparticle that forms an acid complex with cystatin C, a protein found in the body. This antibody is designed to specifically target and bind to cystatin C, allowing for its detection and measurement in various research applications.</p>

<p>SERBP1 antibody was raised using the C terminal of SERBP1 corresponding to a region with amino acids DRAKVEFNIRKPNEGADGQWKKGFVLHKSKSEEAHAEDSVMDHHFRKPAN</p>

<p>ABCD3 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKYGLNELKLCFRVRLTKYLYEEYLQAFTYYKMGNLDNRIANPDQLLTQD</p>

<p>Mouse monoclonal PRKCE antibody</p>

<p>CMV protein is a neutralizing agent that targets the telomerase enzyme in human cells. It can be used to produce antibodies that neutralize the activity of telomerase, which is often associated with cancer cells. CMV protein is commonly used in research and diagnostic laboratories within the Life Sciences field. It can also be used as a growth factor in cell culture media to promote cell proliferation and survival. Additionally, CMV protein has been found to interact with tyrosine residues on cell surface receptors, leading to the activation of signaling pathways involved in cellular processes such as proliferation and differentiation. This recombinant protein complex may have therapeutic potential in regenerative medicine or tissue engineering applications. Furthermore, CMV protein has been shown to bind to other proteins such as epidermal growth factor and collagen, suggesting its involvement in various biological processes. Its unique properties make it a valuable tool for studying cellular mechanisms and developing novel therapeutic strategies.</p>

<p>PIGK antibody was raised using the N terminal of PIGK corresponding to a region with amino acids SVYRSVKRLGIPDSHIVLMLADDMACNPRNPKPATVFSHKNMELNVYGDD</p>

<p>TMTC4 antibody was raised using the C terminal of TMTC4 corresponding to a region with amino acids NDHSLMFSLANVLGKSQKYKESEALFLKAIKANPNAASYHGNLAVLYHRW</p>

<p>Rabbit polyclonal APC antibody (Ser2054)</p>

<p>The SUZ12 antibody is a highly effective antiviral agent that belongs to the class of inhibitors in Life Sciences. It has been extensively studied for its ability to target specific growth factors and human serum components, making it a valuable tool in the field of virology. This low-molecular-weight antibody has shown promising results in treating thrombocytopenia, a condition characterized by low platelet count. Additionally, it has been found to possess neutralizing properties against influenza hemagglutinin, making it an ideal candidate for developing antiviral therapies. The SUZ12 antibody can be immobilized on electrodes for use in various applications, and its high specificity makes it an excellent choice for monoclonal antibody-based diagnostics and research.</p>

<p>PCDHA5 antibody was raised using the N terminal of PCDHA5 corresponding to a region with amino acids VYSRRGSLGSRLLLLWLLLAYWKAGSGQLHYSIPEEAKHGTFVGRIAQDL</p>

<p>AARS antibody was raised using the N terminal of AARS corresponding to a region with amino acids DSTLTASEIRQRFIDFFKRNEHTYVHSSATIPLDDPTLLFANAGMNQFKP</p>

<p>The NGAL antibody is a specific antibody that targets the epidermal growth factor (EGF) and tumor necrosis factor-alpha (TNF-α). It falls under the category of Life Sciences and Monoclonal Antibodies. This antibody has been shown to have neutralizing effects on autoantibodies and growth factors such as collagen, transforming growth factor-beta (TGF-beta), and fibronectin. By targeting these factors, the NGAL antibody can help regulate cell signaling pathways and inhibit abnormal cell growth. Additionally, this antibody has been found to be effective in blocking the activation of chemokines, which play a crucial role in inflammation and immune response. With its high specificity and neutralizing properties, the NGAL antibody holds great potential for therapeutic applications in various fields of research and medicine.</p>

<p>GnRHR antibody was raised in mouse using highly pure human gonadotropin releasing hormone receptor as the immunogen.</p>

<p>Purified Polyclonal PPAR gamma antibody</p>

<p>PPP1R3A antibody was raised using a synthetic peptide corresponding to a region with amino acids MEPSEVPSQISKDNFLEVPNLSDSLCEDEEVTFQPGFSPQPSRRGSDSSE</p>

<p>The KRT8 antibody is a highly specialized monoclonal antibody that is used in various assays and research studies in the field of Life Sciences. This antibody specifically targets choline acetyltransferase, an enzyme involved in the synthesis of acetylcholine, a neurotransmitter with cholinergic properties. The KRT8 antibody has been extensively tested and validated for its specificity and sensitivity in detecting choline acetyltransferase in human serum samples.</p>

<p>The NGAL antibody is a monoclonal antibody that is commonly used in scientific research and medical diagnostics. It is designed to specifically bind to neutrophil gelatinase-associated lipocalin (NGAL), an anti-apoptotic protein that is involved in various physiological processes.</p>

<p>Purified Polyclonal COL4A1 antibody</p>