Bioquímicos e reagentes

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SSX2 antibody, catalog no. 70R-8217</p>

<p>ARL8B antibody was raised using the middle region of ARL8B corresponding to a region with amino acids DIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQL</p>

<p>Purified Polyclonal PLA2G4A antibody</p>

<p>Purified Rabbit polyclonal MYOM1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of EPB41 antibody, catalog no. 70R-2838</p>

<p>Rabbit polyclonal 4E-BP1 antibody</p>

<p>Nidogen/Enactin Monoclonal Antibody</p>

<p>Mouse monoclonal NME4 antibody</p>

<p>The EGFR antibody is a highly effective therapeutic agent used in the field of Life Sciences. It is designed to target and neutralize the epidermal growth factor receptor (EGFR), a protein involved in cell growth and division. This antibody belongs to the class of Polyclonal Antibodies, which are derived from multiple sources and are known for their high specificity and affinity.</p>

<p>CD4 antibody (Azide Free) was raised in rat using cloned murine CTL line V41 as the immunogen.</p>

<p>Keratin K18 antibody was raised in Mouse using a purified recombinant fragment of human Keratin K18 (aa391-483) expressed in E. coli as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ATP6V0D2 antibody, catalog no. 70R-2353</p>

<p>Mouse monoclonal PVRL1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C5orf33 antibody, catalog no. 70R-4180</p>

<p>Mouse monoclonal Complement C5b9 antibody (Biotin)</p>

<p>Rabbit polyclonal RFFL antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RNASE11 antibody, catalog no. 70R-5391</p>

<p>Mouse monoclonal VSIG2 antibody</p>

<p>Codeine 6 Conjugate for use in immunoassays</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CTNND1 antibody, catalog no. 70R-2494</p>

<p>HBsAg antibody (FITC) was raised in rabbit using subtypes ad &amp; ay as the immunogen.</p>

<p>ZNF764 antibody was raised in rabbit using the N terminal of ZNF764 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SERPINA5 antibody, catalog no. 70R-5462</p>

<p>LYPLA1 antibody was raised in Rabbit using Human LYPLA1 as the immunogen</p>

<p>NT5E antibody was raised in Mouse using a purified recombinant fragment of NT5E expressed in E. coli as the immunogen.</p>

<p>The STEAP2 antibody is a polyclonal antibody used in the field of life sciences. It is specifically designed to target and bind to the low-density lipoprotein receptor-related protein 1 (LRP1), which plays a crucial role in regulating cell growth and survival. The STEAP2 antibody has been extensively studied and shown to inhibit the binding of growth factors to LRP1, thereby blocking their signaling pathways.</p>

<p>MOV10 antibody was raised using a synthetic peptide corresponding to a region with amino acids AKLDLQQGQNLLQGLSKLSPSTSGPHSHDYLPQEREGEGGLSLQVEPEWR</p>

<p>Purified Rabbit polyclonal OR2B2 antibody</p>

<p>118-269 amino acids: MRGSHHHHHH GMASMTGGQQ MGRDLYDDDD KDRWGSMVPI RQLHYRLRDE QQKSLVLSDP YELKALHLNG QNINQQVIFS MSFVQGEPSN DKIPVALGLK GKNLYLSCVM KDGTPTLQLE SVDPKQYPKK KMEKRFVFNK IEVKSKVEFE SAEFPNWYIS TSQAEHKPVF LGNNSGQDII DFTMESVSS</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NUDT22 antibody, catalog no. 70R-10087</p>

<p>Purified Rabbit polyclonal GNG5 antibody</p>

<p>The Calcitonin antibody is a highly specialized antibody used in the field of Life Sciences. It can be either polyclonal or monoclonal and is specifically designed to target calcitonin, a hormone involved in calcium regulation. This antibody has been extensively used in various assays and research studies to understand the role of calcitonin in different biological processes.</p>

<p>SERPINB7 antibody was raised in rabbit using the N terminal of SERPINB7 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of IBSP antibody, catalog no. 70R-1687</p>

<p>Rabbit Polyclonal ALK antibody (Tyr1586)</p>

<p>HSPA4 antibody was raised using the N terminal of HSPA4 corresponding to a region with amino acids PACISFGPKNRSIGAAAKSQVISNAKNTVQGFKRFHGRAFSDPFVEAEKS</p>

<p>Rabbit polyclonal GSK3 alpha antibody</p>

<p>Rabbit polyclonal XIRP2 antibody</p>

<p>FAM84B antibody was raised in Rabbit using Human FAM84B as the immunogen</p>

<p>The RPS9 antibody is a highly specialized polyclonal antibody that targets specific proteins in the body. It can be used for various applications, including research, diagnostics, and therapeutic purposes. This antibody specifically binds to tumor necrosis factor-alpha (TNF-α), a protein involved in inflammatory processes. By targeting TNF-α, the RPS9 antibody can potentially inhibit its activity and provide relief from inflammatory conditions.</p>

<p>The SH2B3 antibody is a highly specialized monoclonal antibody that is used in the field of Life Sciences. It is specifically designed to target and neutralize influenza hemagglutinin, a virus surface antigen responsible for the infection and spread of the influenza virus. This antibody is produced by a hybridoma cell line, ensuring its high specificity and potency.</p>

<p>Recombinant human CCNG1 protein (His tag)</p>

<p>The TMOD1 antibody is a highly specific monoclonal antibody that targets the glycoprotein TMOD1. This antibody has been shown to neutralize the superoxide produced by TMOD1 dimers, making it an essential tool for researchers studying the role of TMOD1 in various biological processes. The TMOD1 antibody can be used in a wide range of applications, including immunofluorescence, western blotting, and ELISA. It has also been used to study the effects of TMOD1 on interferon signaling and the development of autoimmune diseases. With its high specificity and cytotoxic properties, the TMOD1 antibody is a valuable tool for researchers in the Life Sciences field.</p>

<p>Guinea Pig IgM is a purified immunoglobulin that is commonly used in hybridization and immunological research. It plays a crucial role in various biological processes, including immune response and antibody production. Guinea Pig IgM has been shown to interact with oncostatin, osteopontin, and other proteins, making it an essential tool for studying the function of these molecules. Additionally, monoclonal antibodies derived from Guinea Pig IgM have been used in cancer research to target specific antigens such as mesothelin and e-cadherin. These antibodies have demonstrated high specificity and affinity, making them valuable tools for diagnostic and therapeutic applications. With its wide range of applications and reliable performance, Guinea Pig IgM is a valuable asset for researchers in the field of immunology.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DIP2A antibody, catalog no. 70R-4403</p>

<p>The PCDGF antibody is a highly specialized monoclonal antibody that targets the growth factor associated with non-alcoholic steatohepatitis (NASH). This antibody has been extensively tested and proven to effectively neutralize the activity of this growth factor, preventing its detrimental effects on liver health. By binding to the growth factor, the PCDGF antibody inhibits its ability to induce inflammation and fibrosis in the liver.</p>

<p>MAP4K4 antibody was raised in Mouse using a purified recombinant fragment of MAP4K4(aa400-500) expressed in E. coli as the immunogen.</p>

<p>Mouse monoclonal PARP16 antibody</p>

<p>CHPF antibody was raised in Rabbit using Human CHPF as the immunogen</p>

<p>Tramadol Conjugate for use in immunoassays</p>