Bioquímicos e reagentes
Os bioquímicos e reagentes são substâncias fundamentais para a pesquisa e desenvolvimento em campos como biotecnologia, biologia molecular, farmacologia e medicina. Esses produtos são essenciais para uma variedade de aplicações, incluindo a síntese de compostos, a análise de amostras biológicas, a pesquisa de processos metabólicos e a produção de medicamentos. Na CymitQuimica, oferecemos uma ampla seleção de bioquímicos e reagentes de alta qualidade e pureza, adequados para diversas necessidades científicas e industriais. Nosso catálogo inclui enzimas, anticorpos, ácidos nucleicos, aminoácidos e muitos outros produtos, todos projetados para apoiar pesquisadores e profissionais em seus projetos de pesquisa e desenvolvimento, garantindo resultados confiáveis e reproduzíveis.
Subcategorias de "Bioquímicos e reagentes"
- Biomoléculas(99.116 produtos)
- Por Alvo Biológico(99.076 produtos)
- Por uso/Efeitos Farmacológicos(6.785 produtos)
- Compostos relacionados à criopreservação e aos crioconservantes(21 produtos)
- Desinfetantes, aditivos para aquecimento de líquidos de banho e compostos relacionados(28 produtos)
- Hormónios(346 produtos)
- Biologia Vegetal(6.698 produtos)
- Metabólitos secundários(14.220 produtos)
Foram encontrados 130579 produtos de "Bioquímicos e reagentes"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
PRMT1 antibody
<p>The PRMT1 antibody is a highly specialized monoclonal antibody that targets the growth factor present in blood plasma. It is designed to specifically bind to the PRMT1 antigen, which plays a crucial role in various biological processes. This antibody has been extensively tested and validated using polymerase chain reaction (PCR) techniques.</p>KEAP1 antibody
<p>KEAP1 antibody was raised in rabbit using the C terminal of KEAP1 as the immunogen</p>Pureza:Min. 95%Rabbit anti Rat IgG (H + L) (HRP)
<p>Rabbit anti-rat IgG (H+L) (HRP) was raised in rabbit using rat IgG whole molecule as the immunogen.</p>Pureza:Min. 95%Human Brain Medulla Tissue Lysate
<p>Fresh tissue lysate isolated from the medulla of human brain</p>Pureza:Min. 95%Goat anti Rabbit IgG (H + L) (HRP)
<p>Goat anti Rabbit IgG (H + L) secondary antibody (HRP);Does not crossreact with other non-immunoglobulin serum proteins. This antibody has minimum cross reactivity with human, bovine, mouse and horse serum proteins</p>Pureza:Min. 95%ANKRD13D Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ANKRD13D antibody, catalog no. 70R-4562</p>Pureza:Min. 95%SPOP Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SPOP antibody, catalog no. 70R-8876</p>Pureza:Min. 95%ZNF554 antibody
<p>ZNF554 antibody was raised in rabbit using the N terminal of ZNF554 as the immunogen</p>Pureza:Min. 95%NEK3 antibody
<p>NEK3 antibody was raised using a synthetic peptide corresponding to a region with amino acids FTQMCLGVNHIHKKRVLHRDIKSKNIFLTQNGKVKLGDFGSARLLSNPMA</p>Pureza:Min. 95%A630025C20RIK antibody
<p>A630025C20RIK antibody was raised in rabbit using the N terminal of A630025C20RIK as the immunogen</p>Pureza:Min. 95%KCNH5 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KCNH5 antibody, catalog no. 70R-5121</p>Pureza:Min. 95%Caldesmon antibody
<p>The Caldesmon antibody is a highly specialized inhibitor used in Life Sciences research. It is a monoclonal antibody that specifically targets and binds to caldesmon, a protein involved in transmembrane conductance and cellular signaling pathways. This antibody has cytotoxic properties, making it an essential tool for studying the function of caldesmon in various cellular processes.</p>METTL2B Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of METTL2B antibody, catalog no. 70R-3028</p>Pureza:Min. 95%SDF1 α antibody
<p>SDF1a antibody was raised in rabbit using E. Coli-expressed amino acids 20-89 of murine SDF-1 alpha as the immunogen.</p>Pureza:Min. 95%MAGEA2 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MAGEA2 antibody, catalog no. 70R-9921</p>Pureza:Min. 95%MyoD antibody
<p>The MyoD antibody is a powerful tool used in immunoassays and bioassays for the detection and quantification of MyoD, a transcription factor involved in muscle development. This antibody can be used in various applications, including electrochemical impedance spectroscopy, where it enables the measurement of changes in impedance caused by the antigen-antibody reaction. The MyoD antibody is available as both polyclonal and monoclonal antibodies, providing researchers with options to suit their specific needs. It has been extensively validated for its specificity and sensitivity in detecting MyoD in different sample types.</p>Pureza:Min. 95%ZNF285A Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF285A antibody, catalog no. 70R-8124</p>Pureza:Min. 95%CBP80 antibody
<p>The CBP80 antibody is a protein that specifically targets and binds to the CBP80 protein. It has been shown to have autoantibodies against basic proteins and TNF-related apoptosis-inducing ligand (TRAIL), which are growth factors involved in cell death regulation. The CBP80 antibody can be used in various research applications, such as immunohistochemistry, Western blotting, and ELISA assays. It is commonly used to detect the presence of specific proteins in biological samples, including human serum or tissue extracts. This antibody is a valuable tool for researchers in the life sciences field who are studying various target molecules, such as alpha-fetoprotein or erythropoietin.</p>SERP1 antibody
<p>The SERP1 antibody is a polyclonal antibody that targets nuclear and adipose tissues. It is widely used in life sciences research for its neutralizing properties against glycoproteins. This antibody has been shown to be effective in inhibiting connexin agents and promoting endothelial growth. It can also be used as a diagnostic tool for detecting alpha-fetoprotein levels in human serum. The SERP1 antibody is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs. With its high specificity and affinity, this antibody is an essential tool for studying various biological processes and diseases.</p>PHLDA1 antibody
<p>PHLDA1 antibody was raised using the C terminal of PHLDA1 corresponding to a region with amino acids LAVKSTRQKQQHLVQQQPPSQPQPQPQLQPQPQPQPQPQPQPQSQPQPQP</p>TNKS Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TNKS antibody, catalog no. 70R-2849</p>Pureza:Min. 95%GBP2 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GBP2 antibody, catalog no. 70R-4040</p>Pureza:Min. 95%NR1H3 antibody
<p>The NR1H3 antibody is a highly specialized monoclonal antibody that targets the chemokine receptor NR1H3. This receptor plays a crucial role in the immune response to viral infections by regulating the activity of serine proteases and other key molecules involved in antiviral defense. The NR1H3 antibody has been extensively studied and proven to be effective in neutralizing the activity of NR1H3, thereby inhibiting viral replication and spread.</p>Carbonic Anhydrase VIII antibody
<p>Carbonic Anhydrase VIII antibody was raised using the N terminal of CA8 corresponding to a region with amino acids YEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDC</p>SERPINB2 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SERPINB2 antibody, catalog no. 70R-6016</p>Pureza:Min. 95%Tubulin antibody
<p>Tubulin antibody was raised in mouse using Chicken skeletal muscle cell preparation as the immunogen.</p>
