Bioquímicos e reagentes

<p>The CD115 antibody is a monoclonal antibody that specifically binds to the CD115 receptor, also known as colony-stimulating factor 1 receptor (CSF1R). This receptor is involved in various cellular processes, including cell proliferation, differentiation, and survival. By binding to CD115, the antibody blocks the interaction between CSF1R and its ligand, thereby inhibiting downstream signaling pathways.</p>

<p>Rabbit polyclonal MOT14 antibody</p>

<p>RSV antibody was raised in goat using human RSV isolate as the immunogen.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for bactericidal activity. Through its unique mechanism of action, this drug binds to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Extensive research has shown its high efficacy using advanced techniques like the patch-clamp technique on human erythrocytes. Additionally, it undergoes various metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. This drug also exhibits specific binding to markers expressed at high levels in Mycobacterium tuberculosis strains and effectively inhibits cell growth in culture.</p>

<p>The ActA antibody is a monoclonal antibody that specifically targets the growth factor TGF-beta. It is widely used in the field of Life Sciences for various research purposes. This antibody has been shown to bind to collagen and inhibit its activity, leading to a decrease in the production of dimers and chemokines. Additionally, the ActA antibody has been found to have high affinity for glycopeptides and ferritin, making it an ideal tool for molecular docking studies. Its unique glycosylation pattern also contributes to its high viscosity and stability, allowing for easy immobilization on various surfaces. With its exceptional characteristics, the ActA antibody is an invaluable asset in the field of research and development.</p>

<p>The SMAD3 antibody is a highly specific and sensitive detection tool used in various research applications. It is available as both polyclonal and monoclonal antibodies, allowing for flexibility in experimental design. The SMAD3 antibody targets the protein SMAD3, which plays a crucial role in the TGF-β signaling pathway. This pathway is involved in numerous cellular processes, including cell growth, differentiation, and apoptosis.</p>

<p>TMEM195 antibody was raised using the N terminal of TMEM195 corresponding to a region with amino acids MKNPEAQQDVSVSQGFRMLFYTMKPSETSFQTLEEVPDYVKKATPFFISL</p>

<p>Purified Rabbit polyclonal ELOVL2 antibody</p>

<p>The Lamin B1 antibody is a highly specialized product in the field of Life Sciences. This antibody is designed to specifically target and bind to Lamin B1, a protein involved in various cellular processes. The antibody is monoclonal, meaning it is derived from a single clone of cells and provides high specificity and sensitivity.</p>

<p>Rabbit polyclonal WDR32 antibody</p>

<p>The Dopamine beta Hydroxylase antibody is a highly specialized antibody used in Life Sciences research. It is commonly used for studying endothelial growth and has neutralizing properties. This antibody is colloidal in nature, making it ideal for use in various immunoassays and antigen-antibody reactions.</p>

<p>The Ofloxacin antibody is a medicament that targets E-cadherin expression. It is a monoclonal antibody specifically designed for use in Life Sciences research. This antibody acts as an inhibitor of oncostatin, which plays a role in the regulation of E-cadherin expression. By binding to E-cadherin, the Ofloxacin antibody induces colloidal lysis and promotes cytotoxic effects on cells expressing this glycoprotein. It has been widely used in biochemical and cytotoxic studies, particularly in the field of helicobacter research.</p>

<p>IRF2 antibody was raised in Rabbit using Human IRF2 as the immunogen</p>

<p>The CA 242 antibody is a highly specialized monoclonal antibody that targets specific proteins in the body. It has been extensively studied and proven to be effective in various research areas within the Life Sciences field. This antibody specifically interacts with glial fibrillary acidic protein (GFAP), β-catenin, and oncostatin, among others.</p>

<p>MAOA antibody was raised in Rabbit using Human MAOA as the immunogen</p>

<p>Mouse monoclonal MPP5 antibody</p>

<p>Mouse monoclonal 70 kDa Neurofilament antibody</p>

<p>DGKE antibody was raised using the N terminal of DGKE corresponding to a region with amino acids EAERRPAPGSPSEGLFADGHLILWTLCSVLLPVFITFWCSLQRSRRQLHR</p>

<p>DMRTC2 antibody was raised in rabbit using the N terminal of DMRTC2 as the immunogen</p>

<p>RNF207 antibody was raised using the N terminal of RNF207 corresponding to a region with amino acids CLLDCFHDFCAGCLRGRATDGRLTCPLCQHQTVLKGPSGLPPVDRLLQFL</p>

<p>Rabbit polyclonal Stathmin 1 antibody (Ser15)</p>

<p>GPS1 antibody was raised in Rabbit using Human GPS1 as the immunogen</p>

<p>Troponin T antibody (cardiac) was raised in mouse using free human cTnT as the immunogen.</p>

<p>BCL2 antibody was raised in Rabbit using Human BCL2 as the immunogen</p>

<p>Synpr antibody was raised in rabbit using the middle region of Synpr as the immunogen</p>

<p>AWAT1 antibody was raised using the N terminal of AWAT1 corresponding to a region with amino acids NWCVWTHIRDYFPITILKTKDLSPEHNYLMGVHPHGLLTFGAFCNFCTEA</p>

<p>RHOF antibody was raised using a synthetic peptide corresponding to a region with amino acids DNVLIKWFPEVTHFCRGIPMVLIGCKTDLRKDKEQLRKLRAAQLEPITYM</p>

<p>Rat monoclonal CD71 antibody (PE)</p>

<p>Rabbit polyclonal RPLP0 antibody</p>

<p>The GALE antibody is a monoclonal antibody that targets the glycoprotein GALE. This powerful antibody has been developed for various applications in the field of Life Sciences. It specifically recognizes and binds to the glycan structures on GALE, providing a valuable tool for researchers studying glycan-related processes.</p>

<p>IGFBP2 antibody was raised using the middle region of IGFBP2 corresponding to a region with amino acids LEEPKKLRPPPARTPCQQELDQVLERISTMRLPDERGPLEHLYSLHIPNC</p>

<p>CNTN4 antibody is a highly specialized antibody that is used in the field of Life Sciences for various applications. It is a polyclonal antibody that specifically targets CNTN4, which is a protein involved in cell adhesion and signal transduction. This antibody can be used in research studies to investigate the role of CNTN4 in different biological processes, such as insulin signaling, annexin regulation, glucagon production, and alpha-fetoprotein expression. CNTN4 antibody has been extensively tested and validated for its specificity and sensitivity in detecting CNTN4 protein in human serum and tissue samples. It is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific experimental needs. The use of CNTN4 antibody can help elucidate the mechanisms underlying various physiological and pathological processes and contribute to advancements in biomedical research.</p>

<p>Fibronectin antibody was raised in rabbit using fibronectin purified from human plasma as the immunogen.</p>

<p>293-431 amino acids: MSTGSKQRSQ NRSKTPKNQE ALRMANVAEN SSSDQRQACK KHELYVSFRD LGWQDWIIAP EGYAAYYCEG ECAFPLNSYM NATNHAIVQT LVHFINPETV PKPCCAPTQL NAISVLYFDD SSNVILKKYR NMVVRACGCH LEHHHHHH</p>

<p>Purified recombinant CLPS protein (His tag)</p>

<p>Hydrocodone 6 Conjugate for use in immunoassays</p>

<p>Highly purified Human CA 72-4 protein</p>

<p>Cefuroxime Axetil (USP grade powder) chemical reference substance</p>

<p>The POU4F3 antibody is a highly specialized monoclonal antibody that has various applications in the field of neurology and virology. It has been shown to have neuroprotective properties, making it a valuable tool for studying neurological disorders and potential therapeutic interventions. Additionally, this antibody exhibits antiviral activity by interfering with viral replication processes.</p>

<p>KIF23 antibody was raised using the N terminal of KIF23 corresponding to a region with amino acids MKSARAKTPRKPTVKKGSQTNLKDPVGVYCRVRPLGFPDQECCIEVINNT</p>

<p>Cytokeratin 19 antibody was raised using the N terminal of KRT19 corresponding to a region with amino acids LEVKIRDWYQKQGPGPSRDYSHYYTTIQDLRDKILGATIENSRIVLQIDN</p>

<p>Rabbit polyclonal MRPL9 antibody (FITC)</p>

<p>Rabbit polyclonal Angiogenin antibody (FITC)</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the class of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. This active compound inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. It has been extensively studied and proven to have high human activity using a patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>Mouse monoclonal Mouse anti Human Kappa Light Chain antibody</p>

<p>GINS3 antibody was raised in Rabbit using Human GINS3 as the immunogen</p>

<p>Rabbit polyclonal ETF1 antibody</p>

<p>Rabbit polyclonal AurB/C antibody</p>

<p>The KHSRP antibody is a highly specialized monoclonal antibody that is designed to target and bind to the KHSRP protein. This protein is found in nuclear extracts and plays a crucial role in various cellular processes. The KHSRP antibody has been extensively tested and validated for use in different assays, particularly in Life Sciences research.</p>

<p>The ALDH1L1 antibody is a cytotoxic agent that targets superoxide and inhibits its activity. This antibody specifically binds to ALDH1L1, a protein kinase that plays a crucial role in cell growth and development. By blocking the activity of ALDH1L1, this antibody prevents the production of superoxide, which is known to cause oxidative damage to cells. Additionally, this antibody has been shown to have anti-VEGF (vascular endothelial growth factor) properties, making it an effective inhibitor of angiogenesis. With its high specificity and potency, the ALDH1L1 antibody is a valuable tool in life sciences research for studying cellular processes and developing new therapeutic strategies.</p>