Bioquímicos e reagentes

<p>The PSMA7 antibody is a highly viscous monoclonal antibody that has been developed for use in various applications within the field of Life Sciences. It specifically targets the PSMA7 protein, which plays a crucial role in cellular processes such as interferon and interleukin-6 signaling. This monoclonal antibody is produced using advanced techniques and has been extensively tested to ensure its high quality and specificity.</p>

<p>DLK2 antibody was raised in Rabbit using Human DLK2 as the immunogen</p>

<p>FBXO42 antibody was raised using the middle region of FBXO42 corresponding to a region with amino acids RSMDEAPCVNGRWGTLRPRAQRQTPSGSREGSLSPARGDGSPILNGGSLS</p>

<p>Purified recombinant SRP19 protein (His tag)</p>

<p>The CD116 antibody is a highly specialized monoclonal antibody that targets the CD116 antigen. This antibody has been extensively researched in the field of Life Sciences and has shown promising results in various applications.</p>

<p>Rabbit polyclonal Ku70/80 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for bactericidal activity. This drug works by inhibiting bacterial growth through its binding to DNA-dependent RNA polymerase, effectively preventing transcription and replication. Its efficacy has been extensively tested using advanced techniques such as transcription-quantitative polymerase chain and patch-clamp technique.</p>

<p>LRRC4C antibody was raised using the N terminal of LRRC4C corresponding to a region with amino acids LVVAGLVRAQTCPSVCSCSNQFSKVICVRKNLREVPDGISTNTRLLNLHE</p>

<p>The PDLIM2 antibody is a powerful tool in the field of life sciences. This monoclonal antibody targets PDLIM2, a protein that plays a crucial role in various cellular processes. It has been observed that low levels of PDLIM2 are associated with dopamine dysregulation and may contribute to certain neurological disorders.</p>

<p>Mouse monoclonal MOBKL2B antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ANP32B antibody, catalog no. 70R-3066</p>

<p>Slc25a31 antibody was raised in rabbit using the middle region of Slc25a31 as the immunogen</p>

<p>alpha 2 Macroglobulin antibody (HRP) was raised in goat using human alpha 2 Macroglobulin purified from plasma as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DDAH2 antibody, catalog no. 70R-5792</p>

<p>Cyclopentobarbital  5 Conjugate for use in immunoassays</p>

<p>SLC25A39 antibody was raised using the C terminal of SLC25A39 corresponding to a region with amino acids RVNPLHVDSTWLLLRRIRAESGTKGLFAGFLPRIIKAAPSCAIMISTYEF</p>

<p>TRPC3 antibody was raised using the N terminal of TRPC3 corresponding to a region with amino acids MEGSPSLRRMTVMREKGRRQAVRGPAFMFNDRGTSLTAEEERFLDAAEYG</p>

<p>The Myc antibody is a monoclonal antibody that specifically targets c-Myc, a transcription factor involved in cell growth and proliferation. This antibody has been extensively studied for its ability to neutralize the activity of c-Myc and inhibit its binding to DNA. It has also been shown to disrupt the formation of actin filaments, which are essential for cellular structure and movement. Additionally, the Myc antibody exhibits potent anti-CD33 activity, making it a valuable tool for research and therapeutic applications. With its high specificity and affinity, this antibody is widely used in various fields, including cancer research, immunology, and cell biology. Whether you need to detect c-Myc expression or investigate its downstream signaling pathways, the Myc antibody is an indispensable tool for your research needs.</p>

<p>Pig Gamma Globulin is a highly versatile and valuable protein that plays a crucial role in various biological processes. It acts as a colony-stimulating factor, promoting the growth and development of specific cell types. Additionally, it interacts with transferrin, a protein involved in iron transport, to regulate plasma levels and ensure proper iron homeostasis.</p>

<p>SOHLH1 antibody was raised using the C terminal of SOHLH1 corresponding to a region with amino acids PAWAPAESSPLDVGEPGFLGDPELGSQELQDSPLEPWGLDVDCAGLALKD</p>

<p>CDC20 antibody was raised in rabbit using the N terminal of CDC20 as the immunogen</p>

<p>The IFNAR1 antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to the interferon alpha receptor 1 (IFNAR1). This glycoprotein plays a crucial role in the immune response by mediating the effects of interferons, which are important signaling molecules involved in antiviral and antitumor activities.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FAM78A antibody, catalog no. 70R-9322</p>

<p>Region of Relaxin 2 protein corresponding to amino acids (A-Chain): QLYSALANKC CHVGCTKRSL ARFC and (B-Chain): DSWMEEVIKL CGRELVRAQI AICGMSTWS.</p>

<p>Purified recombinant TPSAB1 protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C1QB antibody, catalog no. 70R-5990</p>

<p>Rabbit polyclonal LAT antibody (Tyr191)</p>

<p>The RPS8 antibody is a highly specialized antibody that targets microvessel endothelial cells. It can be used in various fields, including industrial applications and life sciences research. This antibody is available in both polyclonal and monoclonal forms, allowing for flexibility in experimental design.</p>

<p>NIT2 antibody was raised using the middle region of NIT2 corresponding to a region with amino acids VAKECSIYLIGGSIPEEDAGKLYNTCAVFGPDGTLLAKYRKIHLFDIDVP</p>

<p>The ZFP36 antibody is a powerful tool used in the field of Life Sciences. It is an antibody that specifically targets and binds to the protein known as ZFP36. This protein plays a crucial role in various cellular processes, including the regulation of gene expression and mRNA stability.</p>

<p>DKFZp686E2433 antibody was raised in rabbit using the N terminal of DKFZP686E2433 as the immunogen</p>

<p>Purified Polyclonal CEP290 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CCDC52 antibody, catalog no. 70R-3812</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of WDR89 antibody, catalog no. 70R-3244</p>

<p>FAM3D antibody was raised in Rabbit using Human FAM3D as the immunogen</p>

<p>The RPA2 antibody is a monoclonal antibody with low density that specifically targets influenza hemagglutinin, a glycoprotein found on the surface of the influenza virus. This monoclonal antibody has been extensively studied and shown to have neutralizing properties against various strains of the influenza virus. In addition to its antiviral activity, the RPA2 antibody has also been found to play a role in iron homeostasis and cholesterol metabolism. Its interaction with transferrin and cholesterol oxidase suggests potential therapeutic applications in diseases related to iron metabolism and lipid disorders. With its unique glycosylation pattern, this antibody offers promising opportunities for research in the field of life sciences and may serve as a valuable tool in understanding various cellular processes.</p>

<p>Rat monoclonal CCR7 antibody (biotin)</p>

<p>SFN antibody was raised in rabbit using the N terminal of SFN as the immunogen</p>

<p>Rabbit polyclonal ACTN1 antibody</p>

<p>The AChE antibody is a highly specific antibody used in life sciences research. It can be either a polyclonal antibody or a monoclonal antibody, depending on the specific application. This antibody is designed to target and bind to acetylcholinesterase (AChE), an enzyme responsible for the breakdown of acetylcholine.</p>

<p>ZNF561 antibody was raised in rabbit using the C terminal of ZNF561 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PARP6 antibody, catalog no. 70R-2153</p>

<p>Insulin-Like Growth Factor Monoclonal Antibody (FITC)</p>

<p>CLIC1 antibody was raised using the C terminal of CLIC1 corresponding to a region with amino acids LTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFAST</p>

<p>Armenian Hamster monoclonal PD1 antibody (biotin)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of STK16 antibody, catalog no. 70R-3483</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ARHGAP15 antibody, catalog no. 70R-4375</p>

<p>SF4 antibody was raised using the N terminal of SF4 corresponding to a region with amino acids MSLKMDNRDVAGKANRWFGVAPPKSGKMNMNILHQEELIAQKKREIEAKM</p>

<p>ApoA-IV antibody was raised in Mouse using a purified recombinant fragment of APOA4 (aa21-396) expressed in E. coli as the immunogen.</p>

<p>KCNRG antibody was raised using the middle region of KCNRG corresponding to a region with amino acids DTLLKEGFHLVSTRTVSSEDKTECYSFERIKSPEVLITNETPKPETIIIP</p>