Bioquímicos e reagentes

<p>MTRF1L antibody was raised using the N terminal of MTRF1L corresponding to a region with amino acids ELFTRGGPLRTFLERQAGSEAHLKVRRPELLAVIKLLNEKERELRETEHL</p>

<p>The SMS antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It has been extensively studied for its ability to neutralize epidermal growth factor (EGF) and interleukin-6 (IL-6), two important signaling molecules involved in cellular growth and inflammation. This antibody specifically targets the glycoprotein receptors on the cell surface, blocking their interaction with EGF and IL-6 and preventing downstream signaling events.</p>

<p>IL28R alpha antibody was raised using a synthetic peptide corresponding to a region with amino acids QDVTYFVAYQSSPTRRRWREVEECAGTKELLCSMMCLKKQDLYNKFKGRV</p>

<p>Mouse monoclonal Exendin 4 antibody</p>

<p>Tryptophan Hydroxylase antibody is a highly specialized antibody used in Life Sciences research. It is designed to target and bind to tryptophan hydroxylase, an enzyme involved in the synthesis of serotonin. This antibody can be used for various applications, including immunohistochemistry and Western blotting, to study the expression and localization of tryptophan hydroxylase in different tissues and cell types.</p>

<p>The Myotubularin antibody is a synthetic polypeptide that acts as an antigen in the body. It is commonly used in research and diagnostic applications to detect and study myotubularin, a protein involved in various cellular processes. This antibody specifically targets myotubularin and can be used to identify its presence or absence in biological samples.</p>

<p>Rabbit polyclonal CDC25B antibody (Ser323)</p>

<p>Mouse monoclonal DNAJB1 antibody</p>

<p>PNPLA5 antibody was raised using the C terminal of PNPLA5 corresponding to a region with amino acids NMALEVFSRTKAQLLGPISPPATRVLETSPLQPQIAPHREELGPTHQA</p>

<p>B71 antibody was raised in rabbit using highly pure recombinant murine B7-1 (Mouse B7-1) as the immunogen.</p>

<p>Rabbit polyclonal RABL2A antibody</p>

<p>Purified recombinant EBNA1BP2 protein (His tag)</p>

<p>FRK antibody was raised using the N terminal of FRK corresponding to a region with amino acids LCSPQSQRHGHYFVALFDYQARTAEDLSFRAGDKLQVLDTLHEGWWFARH</p>

<p>IL7 antibody was raised in rabbit using highly pure recombinant human IL-7 as the immunogen.</p>

<p>CTCFL antibody was raised in rabbit using the N terminal of CTCFL as the immunogen</p>

<p>Enhanced Universal Diluent/Blocker/Stabilizer for use in IHC</p>

<p>1-591 amino acids: MRGSHHHHHH GMASMTGGQQ MGRDLYDDDD KDRWGSHMFG KRKKRVEISA PSNFEHRVHT GFDQHEQKFT GLPRQWQSLI EESARRPKPL VDPACITSIQ PGAPKTIVRG SKGAKDGALT LLLDEFENMS VTRSNSLRRD SPPPPARARQ ENGMPEEPAT TARGGPGKAG SRGRFAGHSE AGGGSGDRRR AGPEKRPKSS REGSGGPQES SRDKRPLSGP DVGTPQPAGL ASGAKLAAGR PFNTYPRADT DHPSRGAQGE PHDVAPNGPS AGGLAIPQSS SSSSRPPTRA RGAPSPGVLG PHASEPQLAP PACTPAAPAV PGPPGPRSPQ REPQRVSHEQ FRAALQLVVD PGDPRSYLDN FIKIGEGSTG IVCIATVRSS GKLVAVKKMD LRKQQRRELL FNEVVIMRDY QHENVVEMYN SYLVGDELWV VMEFLEGGAL TDIVTHTRMN EEQIAAVCLA VLQALSVLHA QGVIHRDIKS DSILLTHDGR VKLSDFGFCA QVSKEVPRRK SLVGTPYWMA PELISRLPYG PEVDIWSLGI MVIEMVDGEP PYFNEPPLKA MKMIRDNLPP RLKNLHKVSP SLKGFLDRLL VRDPAQRATA AELLKHPFLA KAGPPASIVP LMRQNRTR</p>

<p>Purified recombinant TXNRD3NB protein (His tag)</p>

<p>VLDL protein is a monoclonal antibody that belongs to the category of Proteins and Antigens. It is commonly used in Life Sciences research and has various applications. VLDL protein has been shown to have colony-stimulating properties, promoting the growth and development of cells. It also plays a role in human serum by interacting with other molecules such as epidermal growth factor. Additionally, VLDL protein can neutralize autoantibodies, which are antibodies that target the body's own tissues. This monoclonal antibody can also interact with calmodulin and phosphatase, two important proteins involved in cellular signaling pathways. Furthermore, VLDL protein is associated with low-density lipoproteins (LDL) and can influence their levels in the blood. Overall, VLDL protein is a versatile molecule with diverse functions in biological systems.</p>

<p>The SMS antibody is a powerful tool in the field of Life Sciences. It is an anti-EGFR (epidermal growth factor receptor) antibody that specifically targets the activated form of EGFR. This antibody has been extensively studied and proven to be effective in inhibiting the activity of EGFR, which plays a crucial role in various cellular processes including cell growth, proliferation, and survival.</p>

<p>Purified Polyclonal TCP1 zeta antibody</p>

<p>Mouse monoclonal HLAABC antibody (biotin)</p>

<p>Rabbit polyclonal SPRR3 antibody</p>

<p>Purified Polyclonal Cytochrome P450 1A1/2 antibody</p>

<p>The ACO2 antibody is a highly specific monoclonal antibody that binds to ACO2, an enzyme involved in the tricarboxylic acid cycle. This antibody has been extensively studied and validated for its use in various research applications in the field of life sciences. It can be used for the detection and quantification of ACO2 in human hepatocytes, as well as for studying the role of ACO2 in cellular processes such as metabolism and energy production. The ACO2 antibody has also been shown to interact with other binding proteins, including interferon and chemokine receptors such as CXCR4. Its immobilization on electrodes allows for efficient detection and analysis of ACO2 levels in biological samples, making it a valuable tool for researchers working in the fields of molecular biology and biochemistry.</p>

<p>Rabbit polyclonal FOXH1 antibody</p>

<p>Mouse monoclonal TOM70 antibody</p>

<p>Turkey RBC antibody (Texas Red) was raised in rabbit using turkey erythrocytes as the immunogen.</p>

<p>The GATA4 antibody is a highly specific and targeted molecule drug that plays a crucial role in the field of Life Sciences. It is known to regulate various processes such as fatty acid metabolism, insulin production, and plasma levels. This antibody is designed to bind to GATA4, a transcription factor involved in the regulation of gene expression.</p>

<p>FBXO5 antibody was raised using the C terminal of FBXO5 corresponding to a region with amino acids ASVQKSAAQTSLKKDAQTKLSNQGDQKGSTYSRHNEFSEVAKTLKKNESL</p>

<p>NASP antibody was raised using a synthetic peptide corresponding to a region with amino acids KEAEGSSAEYKKEIEELKELLPEIREKIEDAKESQRSGNVAELALKATLV</p>

<p>Purified Rabbit polyclonal PECAM1 antibody (Tyr713)</p>

<p>The TFAP2A antibody is a monoclonal antibody that targets the transcription factor AP-2 alpha (TFAP2A). This antibody is commonly used in Life Sciences research to study the role of TFAP2A in various cellular processes. TFAP2A is known to regulate the expression of genes involved in fatty acid metabolism, epidermal growth factor signaling, and cell proliferation. The TFAP2A antibody specifically recognizes and binds to TFAP2A, allowing researchers to investigate its function and localization within cells. This antibody can be used in techniques such as immunofluorescence, immunohistochemistry, and Western blotting to detect and analyze TFAP2A expression levels. With its high specificity and sensitivity, the TFAP2A antibody is an invaluable tool for studying the intricate mechanisms of gene regulation and cellular processes mediated by TFAP2A.</p>

<p>Rabbit polyclonal MAK antibody (Tyr159)</p>

<p>The BRCA1 antibody is a highly specialized cytotoxic agent used in life sciences research. It is available as both polyclonal and monoclonal antibodies. This antibody specifically targets the BRCA1 protein, which is involved in DNA repair and maintenance of genomic stability. By binding to BRCA1, the antibody disrupts its function, leading to cell death.</p>

<p>MRPL10 antibody was raised using the N terminal of MRPL10 corresponding to a region with amino acids HRRVMHFQRQKLMAVTEYIPPKPAIHPSCLPSPPSPPQEEIGLIRLLRRE</p>

<p>The PDIA4 antibody is a monoclonal antibody used in life sciences research. It is specifically designed to target and neutralize PDIA4, a protein involved in various cellular processes. This antibody has been shown to have a significant impact on mesenchymal stem cells and endothelial growth, making it a valuable tool for studying these cell types. Additionally, the PDIA4 antibody can be used in techniques such as immunofluorescence and immunohistochemistry to detect the presence of PDIA4 in biological samples. Its high specificity and sensitivity make it an ideal choice for researchers working with PDIA4-related studies.</p>

<p>ANAPC7 antibody was raised using the C terminal of ANAPC7 corresponding to a region with amino acids ALSLDPNDQKSLEGMQKMEKEESPTDATQEEDVDDMEGSGEEGDLEGSDS</p>

<p>Purified recombinant Human KRT19 protein (His tag)</p>

<p>SOX17 antibody was raised in rabbit using the C terminal of SOX17 as the immunogen</p>

<p>The GPR34 antibody is a highly specialized antibody used in Life Sciences research. It is specifically designed to target and bind to the GPR34 antigen, which plays a crucial role in various cellular processes. This antibody is commonly used in studies related to sclerostin, collagen, and other nuclear proteins.</p>

<p>Rat monoclonal Granzyme B antibody (biotin)</p>

<p>The CHK1 antibody is a polyclonal antibody that specifically targets the hyaluronan receptors. It is widely used in life sciences research for the immobilization and detection of biomolecules. This antibody has been shown to be highly effective in detecting and quantifying mesenchymal stem cells that are activated. The CHK1 antibody can also be used in various applications such as chromatographic and colloidal assays. Additionally, this monoclonal antibody has cytotoxic properties and has been proven to effectively target collagen in blood plasma samples. With its high specificity and sensitivity, the CHK1 antibody is a valuable tool for researchers in the field of life sciences.</p>

<p>Rabbit polyclonal GPR156 antibody</p>

<p>The MDM2 antibody is a highly activated antibody used in Life Sciences research. It belongs to the family of monoclonal antibodies and is colloidal in nature. This antibody targets the MDM2 protein, which plays a crucial role in regulating cell growth and division. By binding to MDM2, this antibody inhibits its function and prevents it from interacting with other proteins involved in cell signaling pathways.</p>

<p>ALKBH3 antibody was raised using a synthetic peptide corresponding to a region with amino acids EMRKKPPPEENGDYTYVERVKIPLDHGTLLIMEGATQADWQHRVPKEYHS</p>

<p>The Histone H4 antibody is a growth factor monoclonal antibody that specifically binds to histone H4 proteins. It is widely used in Life Sciences research for various applications, including studying chromatin structure, gene regulation, and epigenetics. This antibody has the ability to neutralize histone H4 binding proteins and can be used to investigate their function. Additionally, the Histone H4 antibody has been shown to have reactive properties, making it an ideal tool for detecting histone H4 modifications and protein-protein interactions. Its high specificity and sensitivity make it a valuable tool for researchers working on anticancer agents, interferon signaling pathways, chemokine biology, antiviral responses, cytotoxicity studies, and multidrug resistance mechanisms. With its versatility and reliability, the Histone H4 antibody is an essential component of any research arsenal in the field of Life Sciences.</p>

<p>Rabbit Polyclonal NEK9 antibody (Thr210)</p>

<p>TMEM173 antibody is a polyclonal antibody used in life sciences research. It is commonly used to detect and study the role of TMEM173 (also known as STING) in various biological processes. This antibody specifically recognizes TMEM173 and can be used in assays such as immunohistochemistry, Western blotting, and ELISA. TMEM173 is involved in the regulation of immune responses and has been linked to diseases such as cancer, autoimmune disorders, and viral infections. By targeting TMEM173 with this antibody, researchers can gain insights into its function and potential therapeutic applications.</p>

<p>ZNF660 antibody was raised in rabbit using the N terminal of ZNF660 as the immunogen</p>