Bioquímicos e reagentes

<p>Factor B antibody was raised in Mouse using purified factor B from human blood as the immunogen.</p>

<p>Rabbit polyclonal PUB16 antibody</p>

<p>CBFB antibody was raised in Rabbit using Human CBFB as the immunogen</p>

<p>The ORC2 antibody is a powerful tool used in Life Sciences research. It specifically targets the antigen associated with serotonin, which plays a crucial role in various physiological processes. This antibody can be used as a serum marker to detect the presence of autoantibodies or as a molecular marker to study the expression and localization of ORC2 in cells and tissues.</p>

<p>GPSM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids YFYLHDYAKALEYHHHDLTLARTIGDQLGEAKASGNLGNTLKVLGNFDEA</p>

<p>The Myoglobin antibody is an activated monoclonal antibody that belongs to the category of Life Sciences products. It is specifically designed to target and bind to myoglobin, a protein found in human serum. This antibody is highly specific and exhibits strong binding affinity towards myoglobin, making it an effective tool for various applications in research and diagnostics.</p>

<p>ZNF300 antibody was raised in rabbit using the N terminal of ZNF300 as the immunogen</p>

<p>DGCR8 antibody was raised using the N terminal of DGCR8 corresponding to a region with amino acids DKKDEENELDQEKRVEYAVLDELEDFTDNLELDEEGAGGFTAKAIVQRDR</p>

<p>PRKCB1 antibody was raised using the N terminal of PRKCB1 corresponding to a region with amino acids MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFC</p>

<p>The PZP antibody is a monoclonal antibody that targets taxol and oncostatin, which are growth factors involved in various biological processes. This antibody specifically binds to the CD33 antigen, making it an effective tool for research and therapeutic applications. Monoclonal antibodies like the PZP antibody are widely used in the field of life sciences for their ability to selectively target and inhibit specific molecules or pathways. The PZP antibody can be used in hybridization experiments, as well as in the development of inhibitors or activators for CD33-related signaling pathways. It is a valuable tool for researchers studying annexin or collagen-related processes. Whether you're conducting basic research or developing new therapies, the PZP antibody is an essential component in your scientific toolkit.</p>

<p>The Daxx antibody is a highly specialized medicament used in Life Sciences. It is an antibody that specifically targets and neutralizes the epidermal growth factor (EGF). This antibody has been shown to inhibit the glycosylation process of EGF, preventing its activation and subsequent signaling pathways. Additionally, the Daxx antibody has a neutralizing effect on E-cadherin, which plays a crucial role in cell adhesion.</p>

<p>Rabbit polyclonal RAB10 antibody</p>

<p>1-527 amino acids: MGSSHHHHHH SSGLVPRGSH MGKRQHQKDK MYITCAEYTH FYGGKKPDLP QTNFRRLPFD HCSLSLQPFV YPVCTPDGIV FDLLNIVPWL KKYGTNPSNG EKLDGRSLIK LNFSKNSEGK YHCPVLFTVF TNNTHIVAVR TTGNVYAYEA VEQLNIKAKN FRDLLTDEPF SRQDIITLQD PTNLDKFNVS NFYHVKNNMK IIDPDEEKAK QDPSYYLKNT NAETRETLQE LYKEFKGDEI LAATMKAPEK KKVDKLNAAH YSTGKVSASF TSTAMVPETT HEAAAIDEDV LRYQFVKKKG YVRLHTNKGD LNLELHCDLT PKTCENFIRL CKKHYYDGTI FHRSIRNFVI QGGDPTGTGT GGESYWGKPF KDEFRPNLSH TGRGILSMAN SGPNSNRSQF FITFRSCAYL DKKHTIFGRV VGGFDVLTAM ENVESDPKTD RPKEEIRIDA TTVFVDPYEE ADAQIAQERK TQLKVAPETK VKSSQPQAGS QGPQTFRQGV GKYINPAATE QQRKSPQPVP LSPCPRRSPV GVLGTSAPGS SRLPDDH</p>

<p>The VCAM1 antibody is a monoclonal antibody that specifically targets the VCAM1 protein. This protein plays a crucial role in various biological processes, including cell adhesion and migration. The VCAM1 antibody has been extensively studied in the field of life sciences and has shown promising results in research related to cancer, inflammation, and immune response.</p>

<p>The SENP1 antibody is a highly specific monoclonal antibody used in Life Sciences research. It targets the protein SUMO-specific protease 1 (SENP1), which plays a crucial role in the regulation of various cellular processes. This antibody has been extensively validated and is known for its high specificity and sensitivity.</p>

<p>Eotaxin antibody was raised in mouse using highly pure recombinant human eotaxin as the immunogen.</p>

<p>The Agrin antibody is a highly specialized monoclonal antibody that targets the Agrin protein. This protein is found in human serum and plays a crucial role in various cellular processes, including colony-stimulating and actin filament formation. The Agrin antibody has been extensively tested and proven to have neutralizing effects on the Agrin protein, effectively blocking its activity. One of the key features of the Agrin antibody is its ability to specifically bind to the Agrin protein, preventing it from interacting with its receptors. This targeted binding ensures that the toxic effects of excessive Agrin activity are minimized. Additionally, the Agrin antibody has shown promising results in inhibiting the growth and migration of cells that rely on Agrin signaling for their function. In addition to its neutralizing properties, the Agrin antibody has also been used as a research tool in various studies involving cell biology and molecular biology. It has been utilized in experiments investigating the role of Agrin in different biological processes, such as embryonic development</p>

<p>UNC84A antibody was raised using a synthetic peptide corresponding to a region with amino acids QDAVTRRPPVLDESWIREQTTVDHFWGLDDDGDLKGGNKAAIQGNGDVGA</p>

<p>C7orf10 antibody was raised in Rabbit using Human C7orf10 as the immunogen</p>

<p>KEAP1 antibody was raised in Rabbit using Human KEAP1 as the immunogen</p>

<p>ZBTB40 antibody was raised in rabbit using the N terminal of ZBTB40 as the immunogen</p>

<p>BACE1 antibody was raised in Rabbit using Human BACE1 as the immunogen</p>

<p>Rabbit polyclonal MRPS12 antibody</p>

<p>GOLGA1 antibody was raised in Rabbit using Human GOLGA1 as the immunogen</p>

<p>The p90RSK antibody is a monoclonal antibody that is used in Life Sciences research. It is specifically designed to inhibit the activity of p90RSK, a family of serine/threonine kinases. This antibody has been shown to have therapeutic potential in various conditions, including thrombocytopenia and mesenchymal stem cell disorders. By targeting p90RSK, this antibody can modulate the growth factor signaling pathways and regulate cellular processes such as proliferation, differentiation, and apoptosis. Additionally, the p90RSK antibody has been found to interact with chemokines and interleukin-6, further highlighting its potential as a valuable tool in immunological research. With its high specificity and affinity for its target, this antibody offers researchers a reliable tool for studying the role of p90RSK in various biological processes.</p>

<p>Goat anti-mouse IgG (H+L) (Fab'2) was raised in goat using murine IgG whole molecule as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GZMA antibody, catalog no. 70R-5926</p>

<p>The IL1RL1 antibody is a medicament that belongs to the class of polyclonal and monoclonal antibodies. It is cytotoxic and specifically targets the TNF-related apoptosis-inducing ligand (TRAIL) receptor 1 (IL1RL1). This antibody can be used for therapeutic purposes in various diseases where TRAIL signaling is involved, such as cancer. The IL1RL1 antibody binds to IL1RL1 on the surface of cells and induces cell death by activating apoptotic pathways. It has been shown to inhibit the growth and proliferation of cells expressing IL1RL1, making it a potential treatment option for certain types of cancer. Additionally, this antibody has been used in research studies to investigate the role of IL1RL1 in various biological processes.</p>

<p>Anti Cephapirin C monoclonal</p>

<p>A2BP1 antibody was raised using the middle region of A2BP1 corresponding to a region with amino acids TAAAYSDRNQFVFVAADEISCNTSAVTDEFMLPTPTTTHLLQPPPTALVP</p>

<p>SMARCB1 antibody was raised in rabbit using the middle region of SMARCB1 as the immunogen</p>

<p>Synaptophysin antibody was raised in mouse using Synaptophysin from presynaptic vesicles prepared from bovine brain as the immunogen.</p>

<p>CYP2D6 antibody was raised using the middle region of CYP2D6 corresponding to a region with amino acids EAFLPFSAGRRACLGEPLARMELFLFFTSLLQHFSFSVPTGQPRPSHHGV</p>

<p>Purified recombinant JTB protein (His tag)</p>

<p>Mouse monoclonal UBA2 antibody</p>

<p>Rabbit polyclonal SCEL antibody</p>

<p>Rabbit polyclonal GRM2 antibody</p>

<p>The CYP1A2 antibody is an activated monoclonal antibody that falls under the category of Life Sciences. It is specifically designed to target and neutralize the CYP1A2 enzyme, which plays a crucial role in drug metabolism. This antibody has been extensively studied and proven to be effective in various research applications.</p>

<p>Mouse monoclonal PPME1 antibody</p>

<p>Purified recombinant TINAGL1 protein (His tag)</p>

<p>TRIML1 antibody was raised using the middle region of TRIML1 corresponding to a region with amino acids DSVSRKGNLPKPPGDLFSLIGLKIGDDYSLWVSSPLKGQHVREPVCKVGV</p>

<p>Rabbit anti-canine IgG (H + L) (biotin) was raised in rabbit using canine IgG (H&amp;L) as the immunogen.</p>

<p>ARR3 antibody was raised in rabbit using the C terminal of ARR3 as the immunogen</p>

<p>LRRC33 antibody was raised using the N terminal of LRRC33 corresponding to a region with amino acids GLERLRELDLQRNYIFEIEGGAFDGLAELRHLNLAFNNLPCIVDFGLTRL</p>

<p>SLC25A24 antibody was raised using a synthetic peptide corresponding to a region with amino acids FLFNPVTDIEEIIRFWKHSTGIDIGDSLTIPDEFTEDEKKSGQWWRQLLA</p>

<p>Rabbit polyclonal ALK antibody (Tyr1507)</p>

<p>SUPT16H antibody was raised in rabbit using the N terminal of SUPT16H as the immunogen</p>

<p>Purified Polyclonal ATP8 antibody</p>

<p>Mouse monoclonal KRT18 antibody</p>

<p>Rabbit polyclonal SH3BP1 antibody</p>