Bioquímicos e reagentes

<p>The Fractin antibody is a highly specialized monoclonal antibody that has neutralizing properties against androgen. It acts as an inhibitor of cytotoxic growth factors by binding to specific proteins, such as glycoproteins and chemokines. This antibody is commonly used in research settings to study the effects of these growth factors on various cell types.</p>

<p>ACDC antibody was raised using the N terminal Of Acdc corresponding to a region with amino acids KGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIP</p>

<p>HERV antibody was raised in rabbit using residues 42-50 [QRPGNIDAPC] of the HERV protein as the immunogen.</p>

<p>Goat anti-monkey IgM was raised in goat using monkey IgM mu heavy chain as the immunogen.</p>

<p>Rabbit Polyclonal IKK beta antibody (Tyr199)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MTHFD2L antibody, catalog no. 70R-3409</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RPS6KB1 antibody, catalog no. 70R-3692</p>

<p>Rat monoclonal IgG2b Isotype Control Fc fusion protein (FITC)</p>

<p>The CD32 antibody is a highly versatile test compound that has a wide range of applications in various fields. It is a monoclonal antibody that specifically targets the CD32 receptor, which plays a crucial role in immune response regulation. This antibody can be used for research purposes, diagnostic tests, and therapeutic interventions.</p>

<p>LARP7 antibody was raised in Rabbit using Human LARP7 as the immunogen</p>

<p>CDK7 antibody was raised in Rabbit using Human CDK7 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CNDP2 antibody, catalog no. 70R-9478</p>

<p>Purified Rabbit polyclonal SLC9A3R2 antibody</p>

<p>EXOSC2 antibody was raised in Rabbit using Human EXOSC2 as the immunogen</p>

<p>ACTR1B antibody was raised using a synthetic peptide corresponding to a region with amino acids KIKISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEEDGSRAIHRKTF</p>

<p>ABCB6 antibody was raised using a synthetic peptide corresponding to a region with amino acids VTEWRTKFRRAMNTQENATRARAVDSLLNFETVKYYNAESYEVERYREAI</p>

<p>FNBP1L antibody was raised in Rabbit using Human FNBP1L as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PIK3R3 antibody, catalog no. 70R-1640</p>

<p>Dengue Subtype 2</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CHIC1 antibody, catalog no. 70R-1775</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FEZF1 antibody, catalog no. 70R-8890</p>

<p>Mrpl21 antibody was raised in rabbit using the middle region of Mrpl21 as the immunogen</p>

<p>Lamin A/C Monoclonal Antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TRIB1 antibody, catalog no. 70R-3676</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DAGLB antibody, catalog no. 70R-7486</p>

<p>TERE1 antibody was raised in rabbit using residues 32-45 [PEQDRLPQRSWRQK] of the 37 kDa human TERE1 protein as the immunogen.</p>

<p>Recombinant human CYB5R3 protein (His tag)</p>

<p>Rabbit polyclonal RGAP1 antibody</p>

<p>Heat Shock BSA is a protein that plays a crucial role in protecting cardiomyocytes from stress-induced damage. It exists in various isoforms, including a dimer form, and contains hydroxyl groups that are essential for its function. Heat Shock BSA is commonly used in research laboratories and medical facilities to study the response of cells to stress and to develop new medicines. It can be detected using monoclonal antibodies or hybridoma cells that produce specific antibodies against it. The formation of an antibody complex with Heat Shock BSA allows for its detection and quantification in various biological samples, such as blood plasma or human serum. Its importance in the field of Life Sciences makes Heat Shock BSA a valuable tool for studying binding proteins and their interactions with other molecules.</p>

<p>Rabbit polyclonal UBL4B antibody</p>

<p>Rabbit polyclonal AHSA1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SOD1 antibody, catalog no. 70R-1548</p>

<p>ALDH3B2 antibody was raised in Rabbit using Human ALDH3B2 as the immunogen</p>

<p>ZNF766 antibody was raised in rabbit using the C terminal of ZNF766 as the immunogen</p>

<p>Purified Polyclonal ARF4 antibody</p>

<p>CLK1 antibody was raised in rabbit using the N terminal of CLK1 as the immunogen</p>

<p>Rabbit polyclonal RGS13 antibody</p>

<p>EMID2 antibody was raised using the C terminal of EMID2 corresponding to a region with amino acids LAGERGTVGPSGEPGVKGEEGEKAATAEGEGVQQLREALKILAERVLILE</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C14ORF156 antibody, catalog no. 70R-4685</p>

<p>The SLC12A5 antibody is a monoclonal antibody that targets the growth factor receptor HER2. It specifically binds to the carbonyl group on HER2, inhibiting its signaling pathway and preventing cell proliferation. This antibody has been extensively studied in Life Sciences research and has shown promising results in inhibiting the growth of cancer cells that overexpress HER2. Additionally, the SLC12A5 antibody can be used for immobilization on electrodes to study protein-protein interactions or actin filament dynamics. Its high specificity and affinity make it a valuable tool for researchers studying various biological processes. Furthermore, this antibody has cytotoxic activity against cells expressing the antigen CD33, making it a potential therapeutic option for certain types of cancer.</p>

<p>Rat monoclonal CD104 antibody</p>

<p>Rabbit Polyclonal Chk1 antibody (Ser345)</p>

<p>Rabbit polyclonal IFNG antibody (biotin)</p>

<p>NOLA3 antibody was raised using the middle region of Nola3 corresponding to a region with amino acids MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKK</p>

<p>Rabbit polyclonal RSK1/2/3/4 antibody (Ser221/227/218/232)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SOX7 antibody, catalog no. 20R-1133</p>

<p>The IBA1 antibody is a highly specialized monoclonal antibody that is used in Life Sciences research. It specifically targets and binds to the ionized calcium-binding adapter molecule 1 (IBA1) protein, which is primarily expressed in mouse peritoneal macrophages. This antibody is commonly used for immunohistochemistry and immunofluorescence experiments to visualize and study the activation and behavior of macrophages in various tissues.</p>

<p>Purified recombinant Human CETN1 Protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NR0B1 antibody, catalog no. 70R-1933</p>

<p>Purified Polyclonal MRPS12 antibody</p>