Bioquímicos e reagentes

<p>The SARS-CoV-2 Nucleocapsid Protein is a vital component of the coronavirus responsible for the COVID-19 pandemic. It plays a crucial role in viral replication and assembly. This protein has been extensively studied for its potential therapeutic applications and diagnostic purposes.</p>

<p>Charybdotoxin is a potent and selective ion channel inhibitor. It is a peptide that binds to the receptor site of the potassium channels that are found in nerve cells, blocking their activation. Charybdotoxin has also been shown to inhibit the activity of ligand-gated ion channels, such as acetylcholine receptors. This toxin has been used in research as a tool for studying protein interactions and has also been used in pharmacology as an experimental drug for treating hypertension.</p>

<p>Teduglutide is a Glucagon-like Peptide-2 Analog which has been used in the treatment of Short Bowel Syndrome. It is avaiable in the Trifluoroacetate salt form.<br>One-Letter Formula: HGDGSFSDEMNTILDNLAARDFINWLIQTKITD</p>

<p>Custom research peptide; min purity 95%.</p>

<p>(3,5-Difluorophenylacetyl)-Ala-Phg-OtBu is a secretase inhibitor that inhibits the enzyme that cleaves amyloid precursor protein (APP) to release beta-amyloid. It has been shown to prevent the formation of plaques in the brain and may be used to treat Alzheimer's disease. (3,5-Difluorophenylacetyl)-Ala-Phg-OtBu has also been shown to inhibit the production of tumor necrosis factor alpha (TNFα), which is involved in inflammation and carcinogenesis. The drug has been shown to reduce myocardial infarct size by preventing cardiac cell death and reducing inflammation following a heart attack. It is also active against multiple types of cancer cells, including carcinoma cell lines and multidrug resistant cells.</p>

<p>Peptide H-SV^EGSCGF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>The alpha 1 Antitrypsin protein is a vital component in the field of Life Sciences. It is commonly used in forskolin assays, colloidal microspheres, and as an antigen for monoclonal antibody production. This protein plays a crucial role in inhibiting serine proteases, such as neutrophil elastase, which can cause tissue damage. It also acts as a regulator of interleukin activity and phosphatase enzymes.</p>

<p>Metastin is a peptide that activates the Kisspeptin receptor. It has been shown to inhibit protein interactions, activate ligands and receptors, and act as a research tool in cell biology. Metastin is an inhibitor of the G-protein coupled receptor, KISS1R. Metastin has been shown to activate the LGR5 receptor.</p>

<p>CLEAR-OXTM is a highly effective polymer-supported reagent for the formation of disulfide bonds. Developed by Peptides International, incorporated to the Cymit Quimica Group through vivitide, CLEAR-OXTM combines the power of solid phase chemistry with the versatility of solution-phase reactions.<br>CLEAR resin, compatible with both aqueous and organic environments, is transformed to CLEAR-OX through attaching a lysine-preformed cyclic Ellman’s reagent (DTNB) to a CLEAR polymeric support. Since the mechanism is based on peptide capture, sensitive residues such as Tyr, Trp, and Met are not affected, leading to increased purity and yield.<br>Single disulfide-bridged peptides with constrained amino acids have been successfully produced using CLEAR-OX with various ring sizes and lengths. Oxidations are performed at higher concentrations than solution methods, leading to reduced solvent use at scale. Furthermore, oxidations can be carried out immediately after cleavage with only two-fold CLEAR-OX excess to obtain satisfactory yields. There is also potential for recycling and automation.</p>

<p>Boc-D-Arg(Tos)-OH is an analytical grade building block for the synthesis of D-amino acids. It is used as a reagent for the synthesis of Boc-protected D-amino acids and as a precursor to other amino acid derivatives. The chemical name is N-[2,6-diaminopimeloyl]glycine ethyl ester hydrochloride. Boc-D-Arg(Tos)-OH is soluble in ethyl acetate and methanol, but not in water or ethanol. This product can be used to synthesize peptides with desired properties.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide Ac-EEMQRR^-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-EFFVGLSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VVGAVGVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-DSGSSLIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Mouse monoclonal D-dimer antibody (Biotin)</p>

<p>Myelin PLP (139-151) acetate salt is a cyclic peptide that is derived from the sequence of human myelin basic protein and contains the sequence PLP (139-151). This peptide has shown to have antioxidative properties. It has been shown to have an inhibitory effect on the production of proinflammatory cytokines in experimental autoimmune encephalomyelitis (EAE), which is a model for multiple sclerosis. The peptide has also been shown to block signal pathways, such as toll-like receptor 4, and decrease Ca2+ overload. Clinical relevance remains unclear.</p>

<p>Peptide H-YSQAVPAVTEGPIPEVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide Ac-Rpr-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Dabcyl-γ-Abu-Ser-Gln-Asn-Tyr-Pro-Ile-Val-Gln-Edans is a bifunctional peptide that inhibits HIV protease. The peptide binds to the active site of the enzyme and blocks access to the catalytic triad, inhibiting its function. This peptide has been shown to inhibit viral life in human cells infected with HIV type 1 (HIV1), as well as virions, which are released into the bloodstream. Dabcyl is a small molecule inhibitor of HIV1 protease that also inhibits cellular proteases. It has been shown to inhibit viral life in human T cell lines (THP1) and other cells infected with HIV type 1 (HIV1).</p>

<p>Fmoc-11-Aminoundecanoic Acid is a molecular modeling reagent that interacts with other elements to form Building Blocks. Fmoc-11-Aminoundecanoic Acid has been shown to have cancer interacting properties, elucidating the molecular interactions of peptides and proteins. It has been used in research as an active analog for growth factors. Fmoc-11-Aminoundecanoic Acid interacts with other molecules, including peptides and proteins, by proteolysis to produce new molecules. The chemical structure of this molecule can be altered through reactions with other molecules such as amino acids or nucleotides.</p>

<p>Peptide H-SRTPSLPTPPTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Boc-Val-Leu-Lys-AMC is a research tool that has been shown to activate ion channels and increase the permeability of cell membranes. This compound also binds to receptors on cells, which may be due to its ability to bind with antibodies. Boc-Val-Leu-Lys-AMC has been used as an inhibitor in protein interactions and pharmacology studies, as well as for the study of ion channels in cell biology.</p>

<p>Peptide H-AAVYHHFISDGVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-DRV^YIHP^F^HL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-IYGYPKKGHGHSYTT-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-IYGYPKKGHGHSYTT-OH is provided at greater that &gt;90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-IYGYPKKGHGHSYTT-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-IYGYPKKGHGHSYTT-OH at the technical inquiry form on this page</p>

<p>Peptide H-VEHWGL^DEPL^LK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Fmoc-Lys(Biotin)-OH is a biotin-reactive derivative of the lysine amino acid. It is used to study the interactions between bacterial pathogens and human cells. Fmoc-Lys(Biotin)-OH has been shown to inhibit the growth of P. aeruginosa in thp-1 cells, which are immortalized human lung epithelial cells. This drug also inhibits the synthesis of proteins in the cell nuclei, which prevents the development of bacterial colonies on solubilized cell nuclei in human serum. The effects of Fmoc-Lys(Biotin)-OH have been observed using an unlabeled drug and preincubation with unlabeled protein to observe cytosolic protein synthesis inhibition. A confocal microscope was used to show that Fmoc-Lys(Biotin)-OH inhibited recombinant proteins that bind to human pathogens, such as Staphylococcus a</p>

<p>Octreotide is a drug that belongs to the macrocycle class of polymers. It is used in the treatment of cancer, as well as for diseases such as diabetes mellitus and acromegaly. Octreotide has been shown to inhibit p-glycoprotein (P-gp) and other drug transporters, which leads to an increase in oral bioavailability. In addition, octreotide also inhibits cellular proliferation by interfering with intracellular signalling pathways and protein synthesis. This drug has been shown to have a wide range of biochemical properties and is being investigated as an investigational agent for the treatment of various cancers.</p>

<p>Cyclo[Arg-Ala-Asp-D-Phe-Lys(Biotin-PEG-PEG)] is a peptide containing polyethylene glycol (PEG) as spacer to alter their pharmacokinetic properties and pharmodynamics.</p>

<p>Peptide LCBiot-AAKIQASFRGHMARKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds with bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, inhibiting bacterial growth and preventing transcription and replication. It has been extensively studied using a patch-clamp technique on human erythrocytes, showing its high frequency of human activity. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed in Mycobacterium tuberculosis strains, inhibiting cell growth in culture.</p>

<p>Peptide Ac-YGGFLRRQFKVVT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-TPDVSSAL^DK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>β-Sheet Breaker Peptide iAß5 (Bulk) is a peptide that inhibits the formation of β-sheets in proteins. It has been shown to be an excellent inhibitor of protein interactions, with good selectivity for its target. This peptide also has high purity and can be used as a research tool for studying the function of ion channels and antibodies.</p>

<p>The M13 phage antibody is a powerful tool in the field of Life Sciences. This antibody is specifically designed to target and bind to steroids, making it an essential component in various research applications. By utilizing an activated electrode, scientists can easily detect and measure the concentration of cortisol, a stress hormone, in biological samples. The M13 phage antibody also plays a crucial role in recombination studies, allowing researchers to manipulate DNA sequences and create novel genetic constructs. Additionally, this antibody has been used to study the glycoprotein composition of various test substances, providing valuable insights into their structure and function. With its high specificity and affinity, the M13 phage antibody is widely used in the production of Monoclonal Antibodies for diagnostic and therapeutic purposes. It has also been employed in liver microsome studies to investigate drug metabolism and evaluate potential drug-drug interactions. Furthermore, this versatile antibody has shown promise in regulating interleukin-6 levels, a key cytokine involved in immune response modulation</p>

<p>Peptide Ac-HWRGWVC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>MOCAc-Lys-Pro-Leu-Gly-Leu-Dap(Dnp)-Ala-Arg-NH2 is a peptide that has been shown to inhibit the activity of ADAM17. It blocks the cleavage of proMMP1, MMP2, and MMP9 and inhibits collagenase, stromelysin, and cathepsin activities. This peptide may be useful for the prevention and treatment of diseases associated with excessive proteolytic activity such as arthritis or cancer.</p>

<p>Peptide H-LPLSLPVGPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Please enquire for more information about Homoglutathione H-Glu(Cys-b-Ala-OH)-OH trifluroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Pro-Pro-Gly is a research tool that is used as an activator, ligand, or receptor in cell biology. Pro-Pro-Gly contains a Gly residue at the end of the peptide chain. It can be used to inhibit ion channels and can be synthesized using a high purity technique. Pro-Pro-Gly has been shown to have the ability to bind to antibodies and other proteins, which may be used for pharmacological purposes.</p>

<p>Goat anti Mouse IgG2a secondary antibody (Alk Phos)</p>

<p>H-His-D-Trp-D-Lys-Trp-D-Phe-Lys-NH2 is an inhibitor of cyclase that blocks the conversion of ATP to cAMP. It has shown to have potential as a biomarker for cancer tissues and can be used in experimental models of cancer. HHDLKPDTDLKYSHN2 also inhibits phosphodiesterase, which is involved in the breakdown of cAMP, and can be used to treat bowel disease.</p>

<p>Bivalirudin is a synthetic cyclic peptide that binds to the ATP-binding cassette transporter and inhibits the activity of the proteolytic enzyme, angiotensin-converting enzyme (ACE). ACE inhibition prevents the conversion of angiotensin I to angiotensin II. Bivalirudin has been shown to be effective in reducing mortality in patients with acute coronary syndrome or undergoing percutaneous coronary intervention. It has also been shown to have pharmacokinetic properties that are similar to those of heparin. The drug has a low dose and is not associated with an increased risk of bleeding. Bivalirudin is an inhibitor and can cause drug interactions when combined with other drugs that are inhibitors or substrates for this type of transporter.</p>

<p>Boc-Trp(CHO)-OH is a peptide that is an activator of the ion channel TRPV1. It binds to the receptor for capsaicin and then causes a conformational change in the receptor protein, which leads to activation of the ion channel. Boc-Trp(CHO)-OH is used as a research tool in pharmacology, cell biology, and antibody production. This peptide can be synthesized with high purity and has been shown to have inhibitory effects on TRPV1 channels.</p>

<p>Alpha 1 Antitrypsin antibody was raised in goat using human alpha-1-antitrypsin from normal human plasma as the immunogen.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for bactericidal activity. Through its unique mechanism of action, this drug binds to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its efficacy has been demonstrated through extensive research using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique.</p>

<p>Peptide Ac-CERSDSKQDKSRLNETTETQRT-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>IGF1 antibody was raised in mouse using human insulin-like growth factor I as the immunogen.</p>