Bioquímicos e reagentes

<p>The Anti-HIV p24 antibody is a monoclonal antibody used in Life Sciences research. It has high specificity and affinity for the p24 protein, which is a target molecule in HIV infection. This antibody is commonly used as a tracer in experiments to detect the presence of p24 protein in samples.</p>

<p>Peptide Ac-MTATHAVDEAVS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide LCBiot-AESPKKP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GAGSSEPVTGLDAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-AALEDTLAETEAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-QIVQNLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-LNILNNNYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>The EBNA1 protein is a crucial component in the field of Life Sciences. It plays a role in various biological processes such as genotoxicity, colloidal interactions, and growth factor signaling. This protein interacts with acetylcholine receptors and has been found to modulate the release of interleukin-6, a key cytokine involved in immune responses. Additionally, the EBNA1 protein has neutralizing properties that can be harnessed for therapeutic purposes.</p>

<p>Thyroxine antibody is a multidrug monoclonal antibody that specifically targets galectin-3. This neutralizing antibody has been shown to inhibit the activity of galectin-3, which plays a role in various diseases and conditions. Monoclonal antibodies are highly specific and can be used to target biomolecules such as interferons, autoantibodies, steroids, glucagon, basic proteins, and collagens. The use of monoclonal antibodies allows for precise targeting of specific biomolecules involved in disease processes, making them valuable tools in diagnostics and therapeutics. With their high specificity and potency, monoclonal antibodies have revolutionized the field of medicine and offer promising treatment options for a wide range of diseases.</p>

<p>Peptide Ac-IEELQSNHGVDDEDSDNDG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Cy5-TFSDLWKLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VQHNTKYSVVIR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>NFATc1 antibody was raised in rabbit using residues 211-223 [SPKTTDPEEGFPR] of the human NFATc1 protein as the immunogen.</p>

<p>Peptide H-GPSVFPLAPSSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-Myr-GSNK^SK^PK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-LDLER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-FFVPPFQQSPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-QFYDQALQQAVVDDDANNAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-GRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGR-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>

<p>Mouse Monoclonal Norovirus G1 antibody</p>

<p>Human IgA antibody was raised in goat using human IgA protein, purified as the immunogen.</p>

<p>Peptide H-NFLINETAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Crude antiserum was purified by affinity chromatography from a glycine elute using peptide specific antigen</p>

<p>H-KLVVVGACGV-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-YLWEWASVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-HIFDHVIGPEGVLAGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Region of Myostatin beta protein corresponding to amino acids DFGLDCDEHS TESRCCRYPL TVDFEAFGWD WIIAPKRYKA NYCSGECEFV FLQKYPHTHL VHQANPRGSA GPCCTPTKMS PINMLYFNGK EQIIYGKIPA MVVDRCGCS.</p>

<p>Prolactin antibody is a highly specialized monoclonal antibody that is used in Life Sciences research. It specifically targets and binds to prolactin, a hormone involved in various physiological processes. This antibody can be used in experiments to study the role of prolactin in different cell types, such as granulosa cells. The antibody forms a complex with prolactin, allowing researchers to detect and measure the levels of prolactin in samples using techniques like ELISA or Western blotting. Additionally, this monoclonal antibody has neutralizing properties, meaning it can inhibit the biological activity of prolactin. The Prolactin antibody is an essential tool for scientists investigating the functions and mechanisms of this important hormone.</p>

<p>Peptide H-LLDEVTYLEASK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Beta lipotropin antibody was raised in rabbit using N-terminal portion of bovine species beta-lipotropin conjugated to thyroglobulin as the immunogen.</p>

<p>Peptide H-EQQCVIMAENR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-WYQNMIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>The Testosterone antibody is a human monoclonal antibody that specifically targets the protein hormone testosterone. It is widely used in Life Sciences research for various applications. This antibody has been shown to effectively bind to testosterone and inhibit its activity. It can be used as a powerful tool for studying the role of testosterone in different biological processes. The Testosterone antibody is designed to recognize both free testosterone and testosterone bound to carrier proteins. It has high specificity and sensitivity, making it an ideal choice for detecting and quantifying testosterone levels in biological samples. In addition, this antibody can be used as a diagnostic tool for conditions related to abnormal testosterone levels, such as hormonal imbalances or certain diseases. Its ability to selectively bind to testosterone makes it a valuable asset in clinical settings. The Testosterone antibody is available as a monoclonal antibody, ensuring consistent performance and reproducibility. It is produced using advanced techniques that guarantee high purity and quality. This ensures reliable results in experiments and assays. Furthermore, this antibody has been</p>

<p>Peptide H-GTFASLSELHCDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide PB-PKKKRKV is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GQSIQPFISR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>

<p>Purified recombinant CMV pp150 protein (His tag)</p>

<p>Region of IL13 protein corresponding to amino acids MPVPRSVSLP LTLKELIEEL SNITQDQTPL CNGSMVWSVD LAAGGFCVAL DSLTNISNCN AIYRTQRILH GLCNRKAPTT VSSLPDTKIE VAHFITKLLS YTKQLFRHGP F.</p>

<p>pE-LYENKPRRPYIL is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>

<p>Desloratadine is a tricyclic antihistamine used in the treatment of seasonal allergies, rhinitis and pruritus. This drug binds with H1 receptors blocking the action of endogenous histamine. This leads to a relief in the negative symptoms caused by histamine such as nasal congestion.</p>

<p>Peptide H-LSVPTSEWQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GNPESSFNDENLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Human Serum Albumin</p>

<p>Peptide H-ANELLINVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Please enquire for more information about Chlamydia Trachomatis MOMP Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Peptide H-IGSEAYNQQLSEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-YPIKPEAPGEDASPEEL^NRYYASL^RHYL^NLVTRQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-QQRFEWEFEQQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>