Bioquímicos e reagentes
Os bioquímicos e reagentes são substâncias fundamentais para a pesquisa e desenvolvimento em campos como biotecnologia, biologia molecular, farmacologia e medicina. Esses produtos são essenciais para uma variedade de aplicações, incluindo a síntese de compostos, a análise de amostras biológicas, a pesquisa de processos metabólicos e a produção de medicamentos. Na CymitQuimica, oferecemos uma ampla seleção de bioquímicos e reagentes de alta qualidade e pureza, adequados para diversas necessidades científicas e industriais. Nosso catálogo inclui enzimas, anticorpos, ácidos nucleicos, aminoácidos e muitos outros produtos, todos projetados para apoiar pesquisadores e profissionais em seus projetos de pesquisa e desenvolvimento, garantindo resultados confiáveis e reproduzíveis.
Subcategorias de "Bioquímicos e reagentes"
- Biomoléculas(99.116 produtos)
- Por Alvo Biológico(99.076 produtos)
- Por uso/Efeitos Farmacológicos(6.785 produtos)
- Compostos relacionados à criopreservação e aos crioconservantes(21 produtos)
- Desinfetantes, aditivos para aquecimento de líquidos de banho e compostos relacionados(28 produtos)
- Hormónios(346 produtos)
- Biologia Vegetal(6.698 produtos)
- Metabólitos secundários(14.220 produtos)
Foram encontrados 130579 produtos de "Bioquímicos e reagentes"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
H-RPFYSNAPQEIFIQQGR^-OH
<p>Peptide H-RPFYSNAPQEIFIQQGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>SARS Coronavirus Antibody
<p>The SARS Coronavirus Antibody is a specific antibody that targets the SARS-CoV virus. It has been extensively tested and proven to bind specifically to the virus, inhibiting its replication and spread. This monoclonal antibody is produced using advanced techniques such as polymerase chain reaction (PCR) and transcription-polymerase chain reaction (RT-PCR). It specifically targets the α subunit of the virus, which is crucial for its survival and replication.</p>H-AKPALEDLR^-OH
<p>Peptide H-AKPALEDLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>ATPase antibody
<p>ATPase antibody was raised in rabbit using highly purified Na+, K+ ATPase from rabbit kidney, enzymatically denatured, as the immunogen.</p>Pureza:Min. 95%Rabies Virus Glycoprotein G antibody
<p>Rabbit polyclonal Rabies Virus Glycoprotein G antibody</p>Pureza:Min. 95%JasmonicAcid-I^-OH
<p>Peptide JasmonicAcid-I^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LNIDLLWSV^-OH
<p>Peptide H-LNIDLLWSV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HSV2 gD antibody
<p>HSV2 gD antibody was raised in mouse using purified HSV from strain BH as the immunogen.</p>HXB2 gag NO-121/aa481 - 495
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecular:1,738 g/molSheep anti Human IgG γ
<p>Human IgG gamma antibody was raised in sheep using human IgG (Fc Fragment) as the immunogen.</p>Pureza:Min. 95%H-NEEGAPQEGILEDMPVDC-OH
<p>H-NEEGAPQEGILEDMPVDC-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-NEEGAPQEGILEDMPVDC-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-NEEGAPQEGILEDMPVDC-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-NEEGAPQEGILEDMPVDC-OH at the technical inquiry form on this page</p>Pureza:Min. 95%Ferritin antibody
<p>Ferritin antibody was raised in goat using ferritin from the human Liver as the immunogen.</p>CMVpp65 - 15 (LVSQYTPDSTPCHRG)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecular:1,660.8 g/molLCBiot-AYEQNPQHFIEDLEK-OH
<p>Peptide LCBiot-AYEQNPQHFIEDLEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VAAGAFQGLR^-OH
<p>Peptide H-VAAGAFQGLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CXCL16 protein
<p>Region of CXCL 16 protein corresponding to amino acids NEGSVTGSCY CGKRISSDSP PSVQFMNRLR KHLRAYHRCL YYTRFQLLSW SVCGGNKDPW VQELMSCLDL KECGHAYSGI VAHQKHLLP.</p>Pureza:Min. 95%TCR γ δ antibody
<p>The TCR gamma delta antibody is a highly specialized globulin that has been developed for use in various research applications. It is a monoclonal antibody that specifically targets and binds to the T-cell receptor gamma delta, an important component of the immune system. This antibody can be used in studies involving human serum, as well as in the detection and analysis of autoantibodies and insulin antibodies. Additionally, it has been shown to have neutralizing activity against certain growth factors such as epidermal growth factor. The TCR gamma delta antibody is widely used in life sciences research and is available in a highly purified form, free from any unwanted excipients. Its high specificity and affinity make it an essential tool for researchers studying immune responses and related processes.</p>Hemoglobin A1c antibody
<p>Hemoglobin A1c antibody was raised in sheep using human hemoglobin A1c as the immunogen.</p>Pureza:Min. 95%H-VLDTSSLTQSAPASPTNK^-OH
<p>Peptide H-VLDTSSLTQSAPASPTNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>NARS antibody
<p>NARS antibody was raised in rabbit using the N terminal of NARS as the immunogen</p>H-ASQFVGSSIHWYQQR^-OH
<p>Peptide H-ASQFVGSSIHWYQQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VIIYEVNK^-OH
<p>Peptide H-VIIYEVNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLIYSASFLYSGVPSR^-OH
<p>Peptide H-LLIYSASFLYSGVPSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HIV2 gp36 protein
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a potent antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. Extensive studies have shown its high frequency of human activity using the patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>Pureza:Min. 95%MLN120B
CAS:<p>Inhibitor of IKKβ serine kinase</p>Fórmula:C19H15ClN4O2Pureza:Min. 95%Cor e Forma:PowderPeso molecular:366.8 g/molBiot-NGNNVNGNRNNN-OH
<p>Peptide Biot-NGNNVNGNRNNN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CTLNF-NH2
<p>Peptide H-CTLNF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>α Tubulin antibody
<p>Alpha tubulin antibody was raised in mouse using alpha-tubulin isolated from chick brain microtubules as the immunogen.</p>Cyc-RGGLCYCRGRFCVCVGR-NH2
<p>Peptide Cyc-RGGLCYCRGRFCVCVGR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>USP18 antibody
<p>USP18 antibody was raised using the N terminal of USP18 corresponding to a region with amino acids MQDSRQKAVRPLELAYCLQKCNVPLFVQHDAAQLYLKLWNLIKDQITDVH</p>HIV1 p24 antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity against the disease-causing bacteria. This drug works by binding to DNA-dependent RNA polymerase, thereby inhibiting transcription and replication. Its efficacy has been demonstrated through extensive research using advanced techniques like the patch-clamp technique on human erythrocytes. In addition to its direct action on Mycobacterium tuberculosis strains, this drug undergoes various metabolic transformations within the body. These include hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. With its unique mechanism of action and targeted effects on tuberculosis bacteria, 6-Fluoro-3-indoxyl-beta-D-g</p>Pureza:Min. 95%Ac-CKATQASQEY-OH
<p>Peptide Ac-CKATQASQEY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>MAT2A antibody
<p>MAT2A antibody was raised in mouse using recombinant human MAT2A (1-395aa) purified from E. coli as the immunogen.</p>H-PKCPEPCPPPKCPQPCPP-NH2
<p>Peptide H-PKCPEPCPPPKCPQPCPP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Biot-TRPPTLSPIPHIP-NH2
<p>Peptide Biot-TRPPTLSPIPHIP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Penicillin Antibody
<p>Penicillin Antibody is a monoclonal antibody that specifically targets and neutralizes the effects of penicillin. It is widely used in the field of life sciences for various applications. This antibody has been extensively tested and validated using luciferase assays, electrochemical impedance spectroscopy, and other techniques. It has been shown to effectively bind to penicillin molecules, preventing their interaction with target receptors and inhibiting their biological activity. Additionally, Penicillin Antibody has been found to reduce the levels of interleukin-6 (IL-6) and cortisol concentration in test subjects, indicating its potential as an anti-inflammatory agent. With its high specificity and potency, this antibody offers a valuable tool for researchers studying penicillin-related phenomena in both academic and industrial settings.</p>Neisseria Gonorrhoeae Antibody
<p>Neisseria Gonorrhoeae Antibody is a monoclonal antibody known as trastuzumab that specifically targets Neisseria gonorrhoeae, the bacteria responsible for causing gonorrhea. This antibody is designed to bind to specific antigens on the surface of the bacteria, leading to their destruction by the immune system. It has been shown to be effective in neutralizing the bacteria and preventing their growth and spread. This antibody can be used in diagnostic tests to detect the presence of Neisseria gonorrhoeae in human serum samples. Additionally, it can be conjugated with streptavidin or other molecules for use in research applications such as immunohistochemistry or flow cytometry. The Neisseria Gonorrhoeae Antibody offers a reliable and accurate tool for the detection and study of this common sexually transmitted infection.</p>HRP antibody
<p>The HRP antibody is a monoclonal antibody that specifically targets and binds to HRP (horseradish peroxidase). It is produced by antibody-secreting cells and has been extensively used in various fields of research, particularly in the Life Sciences. This antibody recognizes non-phosphorylated forms of β-catenin and has been widely employed in studies involving the detection and analysis of β-catenin signaling pathways. Additionally, the HRP antibody has been utilized for immunohistochemistry and immunoblotting techniques to detect the presence of specific proteins in various samples. Its high specificity and sensitivity make it an invaluable tool for researchers working on projects related to collagen synthesis, cox-2 inhibition, syncytia formation, nuclear β-catenin localization, and more. Trust the HRP antibody to provide accurate and reliable results for your experimental needs.</p>Goat anti Human IgE
<p>Human IgE antibody was raised in goat using purified human IgE as the immunogen.</p>Pureza:Min. 95%TNP antibody
<p>The TNP antibody is a polyclonal antibody that specifically targets TGF-beta, a growth factor involved in various biological processes. This antibody has been shown to neutralize the activity of TGF-beta and inhibit its signaling pathway. Additionally, the TNP antibody can bind to alpha-fetoprotein and c-myc, two other important proteins involved in cellular growth and differentiation. This antibody is highly specific and has been extensively tested for its efficacy in various experimental models. It can be used as a research tool to study the role of TGF-beta in adipose tissue development, as well as in cancer progression and metastasis. The TNP antibody is available as both monoclonal and polyclonal forms, allowing researchers to choose the most suitable option for their experiments. With its high affinity and specificity, this antibody is an invaluable tool for studying the complex interactions between growth factors and their receptors.</p>Glicentin (By similarity)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Fórmula:C340H532N108O119S2Peso molecular:8,100.68 g/molInfluenza A protein
<p>The Influenza A protein is a recombinant antigen that plays a crucial role in the immune response against influenza viruses. It acts as a target for antibodies and stimulates the production of interferon, which helps fight off viral infections. This protein is commonly used in research laboratories and diagnostic tests to detect and study influenza viruses.</p>Pureza:90% (Sds-Page)
