Bioquímicos e reagentes

<p>OVA Peptide (323-339) is a Chicken ovalbumin fragment that has been shown to have an immune checkpoint activity. It has been shown to be reactive with ISQAVHAAHAEINEAGR and can be used in the treatment of infectious diseases. This peptide is also used for histological analysis of microglia and toll-like receptor expression in skin cancer. OVA Peptide (323-339) also has the potential for use as a basic protein in α7 nicotinic acetylcholine therapy.</p>

<p>H-Ala-Arg-Val-Tyr-Ile-His-Pro-Phe (ARVIP) is a peptide with structural similarities to angiotensin II. The sequence of ARVIP is derived from the C terminus of angiotensinogen, which is cleaved by renin to form angiotensin I. ARVIP has been shown to produce vasoconstriction in experimental models of hypertension. In addition, ARVIP has been shown to have an inhibitory effect on the activity of angiotensin converting enzyme (ACE), which converts angiotensin I into angiotensin II. This inhibition leads to decreased production of vasoconstrictive substances and increased blood flow.<br>ARVIP also increases blood pressure through its ability to activate alpha 1 adrenergic receptors and stimulate release of norepinephrine from sympathetic nerve endings in the brain stem. It may also lead to an increase in coronary blood flow by</p>

<p>HSV-1/2 Mouse Monoclonal Antibody is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about HSV-1/2 Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>H-His(Trt)-2-ClTrt-Resin (200-400 mesh) 1% DVB is a resin for peptide synthesis. It contains thiols, building blocks, alcohols, amines, and other functional groups. The resin is used as a building block in the synthesis of peptides.</p>

<p>ATM-3507 is a bioactive compound derived from marine microorganisms. This compound is meticulously isolated through advanced biotechnological processes, ensuring purity and efficacy for subsequent studies. Its mode of action involves the modulation of specific biochemical pathways, which is achieved by targeting particular cellular receptors, thereby eliciting a defined biological response.</p>

<p>Dnp-Pro-Leu-Gly-Leu-Trp-Ala-D-Arg-NH2 is a synthetic substrate for the enzyme sodium citrate synthase. Dnp is an inhibitor of the citrate synthase enzyme, which prevents the conversion of oxaloacetate to citrate and the formation of acetyl CoA. The use of deuterium has shown that this compound binds in a manner similar to but more stable than acetic acid. Polyclonal antibodies were raised against this synthetic substrate and found to be effective in inhibiting epidermal growth factor (EGF) synthesis by blocking the activation of EGF receptors on cell surfaces. This process reduces ulceration and cell proliferation in cell culture systems. The antibody also inhibits atherosclerotic lesion development in animal models, as well as collagen production by cells. This protein's tryptophan fluorescence indicates that it is a neutral peptide with a high degree of hydrophob</p>

<p>H-DNITHVPGGGNKKIETHKLT-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-DNITHVPGGGNKKIETHKLT-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-DNITHVPGGGNKKIETHKLT-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-DNITHVPGGGNKKIETHKLT-OH at the technical inquiry form on this page</p>

<p>H-DSTGHVGFIFK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-DSTGHVGFIFK-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-DSTGHVGFIFK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-DSTGHVGFIFK-OH at the technical inquiry form on this page</p>

<p>Treponema pallidum antibody (FITC) was raised in rabbit using highly purified Treponema pallidum as the immunogen.</p>

<p>Human IgM antibody was raised in goat using human IgM as the immunogen.</p>

<p>ARL 67156 is a drug that inhibits the enzyme poly (ADP-ribose) polymerase. It has been shown to have neuroprotective effects in animal models of stroke and traumatic brain injury. ARL 67156 also has inhibitory effects on glutamate release, which may be useful for treating diseases such as Parkinson's disease, depression and schizophrenia. The drug is being investigated as a potential treatment for autoimmune diseases such as rheumatoid arthritis, multiple sclerosis and lupus erythematosus. ARL 67156 has also been shown to have analgesic properties in animal models of inflammatory pain, where it acts through adenosine receptors.<br>!--<br>--&gt;!--<br>--&gt;!--<br>--&gt;</p>

<p>H-SVINDPIYK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-SVINDPIYK-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-SVINDPIYK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-SVINDPIYK-OH at the technical inquiry form on this page</p>

<p>Boc-Glu(OBzl)-OH is a peptide that inhibits the enzyme adenylate kinase. It binds to the ATP binding site on the enzyme and blocks access of the substrate, ADP, to its catalytic site. This prevents ATP from being converted into AMP, which is needed for cellular energy production. Boc-Glu(OBzl)-OH has been used in research as an inhibitor in cell biology and pharmacology studies.<br>The purified product is supplied at high purity with low endotoxin levels.</p>

<p>Boc-Asp(OBzl)-Pro-Arg-MCA is a peptide that can activate the receptor GPRC6A. The peptide has been shown to activate the receptor by binding to it and activating the signal transduction pathway. This peptide is also an inhibitor of ion channels, such as voltage-gated potassium channels. Boc-Asp(OBzl)-Pro-Arg-MCA is a high purity product with CAS No. 113866-00-5.</p>

<p>Human IgA1 protein is a glycoprotein that plays a crucial role in the immune system. It is a type of immunoglobulin that functions as an antibody, providing protection against pathogens and foreign substances. Human IgA1 protein has multiple characteristics and functions, including stimulating hepatocyte growth, acting as an electrode for cellular signaling, and interacting with androgens, collagens, inhibitors, monoclonal antibodies, and other binding proteins.</p>

<p>Cilastatin Ammonium Salt chemical reference substance</p>

<p>Alpha-Mating Factor is a peptide that belongs to the group of ligands. It has been shown to bind to the androgen receptor with high affinity and act as an activator for this receptor. Alpha-Mating Factor is also able to bind to the beta-adrenergic receptor. This protein has been shown to have ion channel activity, which may be due to its inhibition of potassium channels. Alpha-Mating Factor is used in research as a tool for studying cell biology and cell signalling pathways.</p>

<p>H-SGCKNGQIL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-SGCKNGQIL-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-SGCKNGQIL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-SGCKNGQIL-OH at the technical inquiry form on this page</p>

<p>Nerve growth factor (NGF) is a neurotrophic factor and neuropeptide involved in the regulation of specific neurons through control of neuronal growth, maintenance, proliferation, and survival. NGF protein functions as the extracellular ligand for the NTRK1 or the NGFR receptors on the surface of neurons, initiating signalling cascades inside the cell. Binding of NGF causes neurons to mature and differentiate; additionally, NGF is critical in the survival of sympathetic and sensory neurons, as in the absence of NGF these cells will undergo apoptosis.NGF is capable of binding with two classes of receptors, both tropomyosin receptor kinase A (TrkA) and low-affinity NGF receptor (LNGFR) act as ligands for NGF, activating signalling cascades. These receptors are associated with neurodegenerative diseases, implying the potential of NGF as a therapeutic drug target.</p>

<p>6-(4-((3-(Benzyloxy)benzyl)oxy)-6-methoxybenzofuran-2-yl)-2-methoxyimidazo[2,1-b][1,3,4]thiadiazole (6BZT) is a high purity chemical reagent that is used in the field of Life Sciences for research purposes and as a pharmacological tool. 6BZT has been shown to activate the G protein coupled receptor (GPCR). 6BZT binds to the agonist binding site on the GPCR and activates it by increasing intracellular cAMP levels. The activation of this receptor can be observed in cell biology experiments using immunofluorescent staining or western blotting. Research using 6BZT has shown that it inhibits both potassium and sodium ion channels, which are important for cellular function. It also inhibits peptide ligand interactions with its receptor. 6BZ</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>The Glucagon Receptor antibody is a highly potent and activated antibody that targets the glucagon receptor. It has been shown to effectively inhibit VEGF-induced angiogenesis in various studies. This antibody specifically binds to fibrinogen and human serum albumin, allowing for targeted delivery and enhanced efficacy. Additionally, it has been demonstrated to have anticoagulant properties, making it a promising therapeutic option for cardiovascular disorders. The Glucagon Receptor antibody also acts as an endogenous hematopoietic growth factor, promoting the production of insulin and other important factors involved in glucose metabolism. With its wide range of applications in the field of Life Sciences, this Polyclonal Antibody is an invaluable tool for researchers studying various cellular processes. Its unique properties make it suitable for use in electrode-based assays and fatty acid analysis.</p>

<p>Anti-UCP1 antibody</p>

<p>Purified native Human Human Growth Hormone (&gt; 95% pure)</p>

<p>Temozolomide is an imidazotetrazine alkylating agent. It has anti-tumor activity against a broad spectrum of tumors, such as leukemias, lymphomas and solid tumors. Temozolomide induces G2/M arrest, preventing cells from entering mitosis and, therefore, apoptosis. As a drug resistance-modifying agent it is used for studying drug resistance mechanisms in glioblastoma cell lines.</p>

<p>H-EEEVRLKKRKRRRNVDKDPA-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-EEEVRLKKRKRRRNVDKDPA-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-EEEVRLKKRKRRRNVDKDPA-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-EEEVRLKKRKRRRNVDKDPA-OH at the technical inquiry form on this page</p>

<p>3-(2-(Benzyloxy)ethoxy)propan-1-ol is a specialized chemical compound often utilized as an intermediate in organic synthesis, which serves as a solvent or stabilizer for various chemical reactions. This compound originates from the etherification of benzyl alcohol, contributing to its unique properties as a flexible linker in synthetic processes.</p>

<p>Felodipine is a calcium channel blocker and a member of the 1,4-dihydropyridine class of calcium channel blockers that is used to treat high blood pressure and related conditions. Felodipine increases the level of natriuretic peptide in the blood and reduces levels of infectious diseases such as influenza A virus and respiratory syncytial virus (RSV).<br>Felodipine is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready to use products for assay development, screening or other R&amp;D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use.</p>

<p>Hemoglobin antibody was raised in goat using human hemoglobin as the immunogen.</p>

<p>Purified recombinant SLA protein (GST tag) (His tag)</p>

<p>Goat polyclonal CRP antibody</p>

<p>P2-Hp-1935 is an antimicrobial peptide isolated from the skin secretions of the Montevideo tree frog (Hypsiboas pulchellus). P2-Hp-1935 displays activity against Gram positive and negative bacteria.</p>

<p>Apo E antibody was raised in goat using Human Apolipoprotein E as the immunogen.</p>

<p>Reactive red 66 is a reactive dye that is used for wastewater treatment. The high resistance to hydrochloric acid, photo-oxidation, and protease activity make it an ideal candidate for this application. Reactive red 66 has been shown to have the ability to react with proteins and other compounds in the water to form covalent bonds. These bonds are then broken down by reductive mechanisms such as photocatalytic activity, which results in the formation of radicals. Functional groups on the molecule are responsible for its color, while transfer mechanisms between molecules allow it to be soluble in water at low concentrations.</p>

<p>Rabbit polyclonal Ferritin antibody</p>

<p>ABCB4 antibody was raised using a synthetic peptide corresponding to a region with amino acids GRTCIVIAHRLSTIQNADLIVVFQNGRVKEHGTHQQLLAQKGIYFSMVSV</p>

<p>Peptide H-I^LAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Galanin (mouse, rat) is 29 amino acids, 1 less than human galanin. Galanin is a widely distributed neuropeptide in the central nervous, peripheral, and endocrine systems. Galanin interacts with 3 receptor subtypes, GalR1-3. These G protein-coupled receptors are inserted into the plasma membrane. Galanin has a role in energy homeostasis. Central injections of galanin to the amygdala lead to food intake in rats.Galanin has been shown to inhibit glutamate release from the hippocampus. Glutamate has an excitatory effect in the mechanisms of epileptic seizures- therefore, galanin is considered a possible anticonvulsant.  Galanin receptor agonists with anticonvulsant properties have been developed to help seizures. Galanin has also helped provide evidence of neuronal plasticity and degradation. Galanin has been used extensively for administration to animals in vivo including rats and mice to better understand its role and help treat appetite disorders.</p>

<p>Rabbit polyclonal PLCD4 antibody</p>