Bioquímicos e reagentes

<p>Peptide Biot-TRPPTLSPIPHIP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Tyrosinase antibody was raised in mouse using recombinant tyrosinase protein as the immunogen.</p>

<p>H-YDTPTLSVHPGPEVISGEKV-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-YDTPTLSVHPGPEVISGEKV-OH is provided at greater that &gt;90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-YDTPTLSVHPGPEVISGEKV-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-YDTPTLSVHPGPEVISGEKV-OH at the technical inquiry form on this page</p>

<p>Oxybutynin is an antimuscarinic agent that is used to aid the bladder in relaxing and preventing the urge to void. This drug is used in the treatment of an overactive bladder and reduces detrusor muscle activity. Oxybutynin works by inhibiting the action of acetylcholine on smooth muscle.</p>

<p>FP prostaglandin receptor agonist</p>

<p>Represents the extracellular region of amyloid β peptide (Aβ). This region may be responsible for the conformational changes seen in Aβ and is cytotoxic in vitro.Aβ has been identified as the key subunit of the extracellular plaques found in the brains of patients with Alzheimer disease (AD) and Down syndrome (DS). Aβ has therefore been extensively studied as a potential target for treatment of AD.Aβ is formed from the cleavage of the large, transmembrane protein- APP (amyloid precursor protein). Cleavage of APP by β- and then &amp;γ-secretases results in the formation of Aβ. Aβ can aggregate to produce amyloid-β oligomers, which are thought to be highly neurotoxic. Over time Aβ can further aggregate to produce the characteristic senile plaques present in AD and DS. Aβ can be degraded by enzymes such as neprilysin, insulin degrading enzyme or endothelin converting enzyme. At physiological levels Aβ may be involved in controlling synaptic activity and neuronal survival.</p>

<p>crosslinkage:  1% DVBResin: 100 - 200 meshsubstitution:  ca 0.7 meq/g</p>

<p>Feline Calicivirus VP1 Antigen, Recombinant is a protein for use in pharmaceutical and diagnostic applications. Please enquire for more information about Feline Calicivirus VP1 Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Peptide Ac-CKESPVIAKYMPTEAVRVT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>The Influenza A protein is a versatile and multifunctional molecule with various characteristics and applications in the field of Life Sciences. It contains a bromodomain that plays a crucial role in regulating gene expression by recognizing acetylated histones. Additionally, it interacts with fatty acids and acts as a leukocyte elastase inhibitor, which can be beneficial in inflammatory conditions.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Potent and selective inhibitor of polycomb repressive complex 2 (PRC2), by binding to the K27me3-pocket of the regulatory EED subunit. Inhibits H3K27 methylation in histone 3. Has anti-tumor activity in murine xenograft models. Synergistic with EZH2 inhibitor against cancer cell growth.</p>

<p>CD4 antibody was raised in mouse using hybridoma of X63.653 myeloma with spleen cells of Balb/c mice immunized with normal human blood lymphocytes.</p>

<p>Peptide H-EDHLFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>The Influenza A antibody is a potent medicament that belongs to the class of Monoclonal Antibodies. It exhibits cytotoxic properties and targets specific markers expressed by the Influenza A virus. This antibody binds to viral antigens, preventing their interaction with host cells and inhibiting viral replication. Additionally, it has been shown to neutralize the activity of lectins and calmodulin, which are essential for viral entry and propagation. The Influenza A antibody also plays a crucial role in modulating the immune response by inhibiting pancreatic elastase, a key enzyme involved in tissue damage during infection. Its therapeutic potential extends beyond its antiviral effects as it has been found to regulate collagen production and inhibit transforming growth factor-beta (TGF-beta), thereby promoting tissue repair. This monoclonal antibody represents a significant advancement in the field of Life Sciences and holds promise for the treatment and prevention of Influenza A infections.</p>

<p>DNAJA4 antibody was raised in Rabbit using Human DNAJA4 as the immunogen</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide Ac-SIINFEKL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Fibronectin is an extracellular matrix protein that plays a critical role in cell adhesion, migration, and differentiation. Fibronectin subunits are composed of repeating units of three types of modules: type I, type II, and type III. The active fragment of fibronectin refers to a small peptide sequence within the type III modules of fibronectin that has been shown to have potent biological activity.<br>The fibronectin active fragment, also known as the cell-binding domain or RGD domain, is a short peptide sequence consisting of the amino acid sequence Arg-Gly-Asp (RGD). This peptide sequence interacts with cell surface receptors known as integrins, which are important for mediating cell adhesion, migration, and signaling.<br>The fibronectin active fragment has been extensively studied as a research tool to investigate the mechanisms of cell adhesion and migration. It has also been used in tissue engineering applications to promote cell attachment and proliferation on synthetic biomaterials. This product is available as a 0.5mg vial.</p>

<p>IgE Myeloma Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about IgE Myeloma Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Peptide Ac-AGRSL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>CMV antibody was raised in mouse using glycoprotein B of CMV as the immunogen.</p>

<p>H-SVQLMEK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-SVQLMEK-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-SVQLMEK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-SVQLMEK-OH at the technical inquiry form on this page</p>

<p>H-HWSHGQAKISEASATVYNGS-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-HWSHGQAKISEASATVYNGS-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-HWSHGQAKISEASATVYNGS-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-HWSHGQAKISEASATVYNGS-OH at the technical inquiry form on this page</p>

<p>Peptide H-SNLELLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-HNLFEPEDTGQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Serotonin 5-HT3 receptor antagonist; anti-emetic</p>

<p>GARS antibody was raised in Rabbit using Human GARS as the immunogen</p>

<p>Ac-AFGLLTPSQAEC-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-AFGLLTPSQAEC-NH2 is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-AFGLLTPSQAEC-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-AFGLLTPSQAEC-NH2 at the technical inquiry form on this page</p>

<p>H-LGVLLLIGCWYCRRR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LGVLLLIGCWYCRRR-OH is provided at greater that &gt;90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LGVLLLIGCWYCRRR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LGVLLLIGCWYCRRR-OH at the technical inquiry form on this page</p>

<p>Hemoglobin antibody was raised in mouse using human hemoglobin as the immunogen.</p>

<p>Peptide H-YQSSPAKPDSSFYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Etidronate is a bisphosphate drug that is used to treat osteoporosis. It is an inhibitor of bone resorption and works by inhibiting the action of osteoclasts.</p>

<p>Peptide H-RPTLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-NVTGFFQSLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>CEA protein is a surface glycoprotein that plays a crucial role in various biological processes. It is commonly used as a biomarker for certain types of cancer, particularly colorectal cancer. CEA protein can be detected in blood plasma using electrochemical impedance or other techniques. Studies have shown that elevated levels of CEA protein are associated with tumor growth and metastasis.</p>

<p>Peptide H-DAEFRHDSGYEVHHQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>S-Trityl-ß-Mercaptopropionyl-AM Resin is a resin that can be used for peptide synthesis. It is used in the building blocks of protein, and its ligation is used to build peptides. This resin is a building block for protein synthesis and can be used as an alternative to Fmoc-protected amino acids.</p>

<p>Peptide H-ALLTSRLRFI^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-EL^SEALGQIFDSQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Bovine Platelet Lysate (FBS Replacement) is a nutrient-rich cell culture supplement filled with growth factors and cytokines, ethically produced from bovine plasma samples. Bovine Platelet Lysate (bPL) is a cost-effective, consistent quality replacement for FBS in all cell culture applications, and, most importantly, it is slaughter-free and prioritizes animal welfare.<br>bPL can be used with a variety of basal media formulations for optimal growth of many cell types in vitro. It has shown effectiveness in promoting and sustaining the growth of various cell types including, but not limited to: Neural stem cells (NSCs), Human embryonic stem cells (hESCs), Induced pluripotent stem cells (iPSCs), Mesenchymal stem cells (MSCs), Adipose-derived stem cells (ADSCs), Osteoblasts, Bone marrow-derived stem cells, Smooth muscle cells Fibroblasts, Epithelial cells, Endothelial cells, Hepatocytes, Chondrocytes, Cardiomyocytes and various  Cancer cell lines.</p>

<p>Region of M-CSF protein corresponding to amino acids MKEVSEHCSH MIGNGHLKVL QQLIDSQMET SCQIAFEFVD QEQLDDPVCY LKKAFFLVQD IIDETMRFKD NTPNANATER LQELSNNLNS CFTKDYEEQN KACVRTFHET PLQLLEKIKN FFNETKNLLE KDWNIFTKNC NNSFAKCSSR DVVTKP.</p>

<p>Urotensin II (Human) Antiserum is a research tool for the study of ion channels and receptors. Urotensin II is a peptide that interacts with the G-protein coupled receptor, UTA1. The purified antibody can be used to detect the presence of this peptide in a sample by Western blotting or ELISA. This product is supplied in high purity and has not been shown to react with any other protein.</p>

<p>Peptide Ac-QQRFEWEFEQQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>OSMR antibody was raised using the N terminal of OSMR corresponding to a region with amino acids YQSEVLAERLPLTPVSLKVSTNSTRQSLHLQWTVHNLPYHQELKMVFQIQ</p>

<p>Peptide Biot-Ahx-RRRVTSPARRS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Sphingosine is a sphingolipid that can be found in human cells and plays an important role in signal transduction. Sphingosine is synthesized by the enzyme sphingosine kinase from sphinganine, which is a product of the breakdown of phospholipids. It also has a basic structure that can be used to inhibit the activity of protein kinases, such as PKC and Src, and tumor necrosis factor alpha.</p>

<p>Peptide H-YPIKPEAPGEDASPEEL^NRYYASL^RHYL^NLVTRQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>