Bioquímicos e reagentes

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Eliglustat is an oral medication used as a substrate reduction therapy for Gaucher disease type 1, which is an inherited lysosomal storage disorder. This product is a small-molecule inhibitor derived via chemical synthesis. Its primary mode of action involves the selective inhibition of glucosylceramide synthase, an enzyme responsible for the first committed step in glycosphingolipid biosynthesis. By reducing the production of glucosylceramide, eliglustat decreases the substrate accumulation that contributes to the pathophysiology of Gaucher disease.</p>

<p>Ac-CEKTNEKYHQIEKEFEQ-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-CEKTNEKYHQIEKEFEQ-NH2 is provided at greater that &gt;85% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-CEKTNEKYHQIEKEFEQ-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-CEKTNEKYHQIEKEFEQ-NH2 at the technical inquiry form on this page</p>

<p>Biotin-Tat (47-57) is a cell penetrating cationic peptide derived from the N-terminus of the Tat protein, which is a trans-activator of the transcription protein present in the human immunodeficiency virus (HIV). Specifically Biotin-TAT (47-57) is located within the arginine-rich basic domain 48-60 of the TAT peptide which as a whole has three domains which function to aid HIV through transactivation, DNA binding and nuclear transport. As a cell penetrating peptide (CPP) TAT aids in the cellular uptake of molecules and hence serves a valuable purpose in transduction methods. This property has been demonstrated through its ability of allowing toxins such as the neurotoxin Botulinum neurotoxin Type A, produced by the Clostridium botulinum type A bacteria to penetrate the skin barrier non-invasively.This peptide has an uncharged C-terminal amide.</p>

<p>IL33 antibody was raised in mouse using recombinant human IL-33 (112-270aa) purified from E. coli as the immunogen.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-GLPAPIEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Buforin II is a highly potent antimicrobial peptide which was derived from buforin I, a peptide isolated from the stomach of the Asian toad, Bufo bufo garagrizans. Buforin II is an alpha-helical antimicrobial peptide, however it has far stronger antimicrobial activity against a broad spectrum of microorganisms compared with other alpha-helical antimicrobial peptides. Buforin II may have a different mode of action to that of other alpha-helical peptides targeting nucleic acids instead of cell membranes.</p>

<p>H-TITTDLLGSPFQEK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-TITTDLLGSPFQEK-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-TITTDLLGSPFQEK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-TITTDLLGSPFQEK-OH at the technical inquiry form on this page</p>

<p>H-HPAAPSSW-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-HPAAPSSW-OH is provided at greater that &gt;98% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-HPAAPSSW-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-HPAAPSSW-OH at the technical inquiry form on this page</p>

<p>Peptide H-SYKV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Ac-ERQRRNELARSFFALRDQI-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-ERQRRNELARSFFALRDQI-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-ERQRRNELARSFFALRDQI-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-ERQRRNELARSFFALRDQI-OH at the technical inquiry form on this page</p>

<p>Tumstatin is an anti-angiogenic matrikine fragment of collagen IV alpha3 subunit and a VEGF antagonist. Matrikines are bioactive extra cellular matrix (ECM) fragments which regulate cellular metabolism and influence ECM deposition and degradation. Airways of people with asthma have an 18-fold reduction in the levels tumstatin in their airway walls. Tumstatin reverses airway inflammation and remodelling in animal models of asthma in a mechanism involving autocrine remodelling of the ECM. The ECM regulates many aspects of cell biology including gene expression and inflammatory pathways. The airways ECM in asthma has been implicated in airway hyper-responsiveness (AHR), airway thickening, chronic inflammation and increased angiogenesis. Tumstatin fosters an anti-inflammatory and anti-angiogenic microenvironment which inhibits neutrophils in the airway tissue by modifying airway smooth muscle (ASM)-derived ECM. Tumstatin is present in endothelial cells, airway epithelial cells and primary lung fibroblasts, but not in primary ASM cells.</p>

<p>Peptide H-VLIVPQNFVVAAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Viloxazine is a selective inhibitor for norepinephrine uptake over serotonin (5-HT) uptake in rat hypothalamic synaptosomes. It has been studied for its potential uses in treating attention-deficit hyperactivity disorder (ADHD) and depression.Viloxazine hydrochloride is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready-to-use products for assay development, screening or other R&amp;D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide Ac-Kpr-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Apo E antibody was raised in goat using Human Apolipoprotein E as the immunogen.</p>

<p>Peptide H-FGAVYSSDEAL^IPIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-Glu(2-ClTrt-Resin)-OtBu α Ester is an amine building block that is used in the synthesis of peptides. It is a resin that contains thiols and amines. H-Glu(2-ClTrt-Resin)-OtBu α Ester can be used as a building block for the synthesis of pepetides by reacting with an acid chloride or acid anhydride. When reacted with an acid chloride, H-Glu(2-ClTrt-Resin)-OtBu α Ester forms the corresponding ester, which reacts with a thiol to form a thioester. This product can also be used as a building block for the synthesis of polymers by reacting with alcohols to form esters.</p>

<p>Please enquire for more information about Mouse anti Canine IgE including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Teduglutide is a GLP-2 analogue, in which the alanine at position 2 has been substituted with glycine making the peptide resistant to degradation by dipeptidyl peptidase-4 (DPP-4)- Teduglutide therefore has a longer half-life than GLP-2 (2-3 hours for teduglutide vs 7 min for GLP-2). Teduglutide has high bioavailability after subcutaneous administration, suggesting that teduglutide has enhanced biological activity, relative to native GLP-2.GLP-2 is a gut hormone produced in the enteroendocrine L cells of gastrointestinal tract by the cleavage of the 160-amino-acid proglucagon molecule. GLP-2 is secreted following the ingestion of food and carries out its activities via the GLP-2 G-protein coupled receptors (GLP-2Rs). GLP-2 has a range of roles within the cell, including: anti-inflammatory effects- promoting the expansion of the intestinal mucosa- stimulating intestinal blood flow- inhibiting gastric acid secretion and gastric emptying- increasing intestinal barrier function and enhancing nutrient and fluid absorption.</p>

<p>GABA reuptake inhibitor</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Purified recombinant Hepatitis C Virus protein (HRP)</p>

<p>Peptide Fluor-SIINFEKLGSGHWDFAWPW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>LRRKtide (also called moesin) is a peptide substrate for leucine-rich repeat kinase 2 (LRRK2). The sequence of LRRKtide has been derived from the ERM proteins: Ezrin (amino acids 561-573), radixin (amino acids 558-570) and moesin (amino acids 539-553). These proteins influence cytoskeletal dynamics by anchoring the cytoskeleton to the plasma membrane. LRRK2 phosphorylates LRRKtide at its Thr558 site.LRRK2 is a large, ubiquitous protein of unknown function. LRRK2 has GTPase and kinase activity, and is located in multiple areas of the cell where it is found associated with intracellular membranes and vesicular structures. Its multiple cellular locations suggest that LRRK2 may be involved in several cellular pathways. LRRK2 is also found in most organs and mutations in LRRK2 have been identified in Parkinson's disease.This peptides has a non-amidated C-terminal end.</p>

<p>Inhibitor of VEGF receptors</p>

<p>Glycine proline (Gly-Pro) dipeptide is a bioactive collagen hydrolysate. Ingestion of collagen hydrolysate improves skin health. Gly-Pro ingestion specifically attenuates UVB-induced damage including wrinkle formation, trans-epidermal water loss, and epidermis thickness- Gly-Pro also increases skin hydration.</p>

<p>Amino acids 487-496 of Poly(ADP-ribose) polymerase 1 (PARP1). PARP1 is a nuclear DNA repair enzyme that binds to DNA when damage is detected. PARP1 coordinates double and single strand break repair by first cleaving NAD+ into nicotinamide and ADP-ribose, and then synthesising poly-(ADP-ribose) (PAR) chains from ADP-ribose on target proteins (PARylation). PARylation of histone proteins mediates relaxation of the chromatin and recruitment of DNA-break repair enzymes.PARP1 can also act as a transcriptional co-activator, modulating the expression of itself and many other genes by direct binding to or PARylation of enhancers and promoters. PARP1 is also involved in maintaining mtDNA.PARP1 belongs to the PARP family which has 7 known and 10 putative members. PARP1 accounts for &gt;85% of the PARP activity in cellular systems.</p>

<p>Angiotensin II is a peptide hormone that is secreted by the kidneys. It stimulates the release of aldosterone and causes vasoconstriction, leading to an increase in blood pressure. Angiotensin II is also involved in other physiological functions such as the regulation of fluid balance, electrolyte levels, and blood coagulation. The drug is used to treat congestive heart failure and high blood pressure. Sar1-Angiotensin II has been shown to inhibit transcriptional regulation by binding to the angiotensin receptor type 1 (AT1). This binding disrupts conformational changes in the receptor, preventing signal transduction from occurring and decreasing the activity of enzymes such as protein kinase A, which are needed for activation of transcription factors.</p>

<p>H-Phe-Ile-Arg-Val-Val-Met-Tyr-Glu-Gly-Lys-Lys is a biologically active peptide that has been shown to have angiogenic and cardiovascular properties. It has also been demonstrated to inhibit thrombospondin, which is a protein that promotes the formation of blood clots. This peptide is a member of the group of peptides and biochemicals, which are molecules that regulate the processes in living organisms.</p>

<p>Ac-DLEFQLVAPESVTVEC-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-DLEFQLVAPESVTVEC-NH2 is provided at greater that &gt;85% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-DLEFQLVAPESVTVEC-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-DLEFQLVAPESVTVEC-NH2 at the technical inquiry form on this page</p>

<p>H-YDTPTLSVHPGPEVISGEKV-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-YDTPTLSVHPGPEVISGEKV-OH is provided at greater that &gt;90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-YDTPTLSVHPGPEVISGEKV-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-YDTPTLSVHPGPEVISGEKV-OH at the technical inquiry form on this page</p>

<p>Clopidogrel is a potent inhibitor of the platelet aggregation. It reduces blood clotting by inhibiting the ADP receptor on the surface of platelets, thereby inhibiting the aggregation and adhesion of platelets. Clopidogrel has been shown to be effective in preventing thrombosis, myocardial infarction (heart attack), and stroke. Clopidogrel inhibits the activity of cytochrome P450 3A4 (CYP3A4) and p2Y 12 receptors. Clopidogrel has been shown to have synergic effects with nonsteroidal anti-inflammatory drugs (NSAIDs). The polymorphic nature of Clopidogrel can be monitored using a liquid chromatography-tandem mass spectrometry (LC-MS/MS) method for quantification in biological samples such as human serum and plasma.</p>

<p>FP prostaglandin receptor agonist</p>

<p>H-QPQPLPSPGVGGKN-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-QPQPLPSPGVGGKN-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-QPQPLPSPGVGGKN-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-QPQPLPSPGVGGKN-OH at the technical inquiry form on this page</p>

<p>Peptide H-ALEQDLPVNIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>LYVE1 antibody was raised using the N terminal of LYVE1 corresponding to a region with amino acids ARCFSLVLLLTSIWTTRLLVQGSLRAEELSIQVSCRIMGITLVSKKANQQ</p>

<p>The gp130 antibody is a powerful tool in the field of Life Sciences. It specifically targets the circumsporozoite protein, which plays a crucial role in various cellular processes. This monoclonal antibody recognizes and binds to the nuclear actin, providing researchers with valuable insights into actin dynamics and function.</p>

<p>H-RSTSHTSDFNPNSGSDQRVV-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-RSTSHTSDFNPNSGSDQRVV-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-RSTSHTSDFNPNSGSDQRVV-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-RSTSHTSDFNPNSGSDQRVV-OH at the technical inquiry form on this page</p>

<p>Please enquire for more information about Biotinyl-(Cys1,Lys(biotinyl)18)-Calcitonin (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>A reversible and selective inhibitor of thrombin that rapidly binds to the catalytic site directly. Inhibits both soluble and bound forms of thrombin. Used for prophylaxis and treatment of heparin-induced thrombocytopenia type II.</p>

<p>2-Chlorotrityl Chloride Resin (200-400 mesh) 1% DVB is a resin that is used as a building block for peptide synthesis. It can be used to synthesize the building blocks for peptides, including amino acids, alcohols and amines. 2-Chlorotrityl Chloride Resin (200-400 mesh) 1% DVB has been shown to react with thiols, alcohols and amines in solution to form covalent bonds. It can also be used as a tool in the synthesis of thiols, alcohols or amines.</p>

<p>Amiodarone a class III anti-arrhythmic agent, used to treat and prevent certain types of irregular heartbeats. It is a competitor for natural ligands of alpha and beta adrenergic receptors, muscarinic acetylcholine receptors, histamine H1 receptors, and serotonin 5HT2A/5HT2C receptors. Amiodarone has been shown to reduce the number of atrial and ventricular arrhythmias in patients with structural heart disease, and has been used to treat atrial fibrillation, ventricular tachycardia, and Wolff-Parkinson-White Syndrome. It has also been used in the prevention of myocardial infarcts due to its ability to modify blood pressure and maintain cardiac function. In addition, amiodarone inhibits prostaglandin synthesis by inhibiting cyclooxygenase enzymes. This prevents inflammation in the gastrointestinal tract and reduces bowel disease symptoms such as cramping or diarrhea.</p>

<p>H-NLKRAFSLK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-NLKRAFSLK-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-NLKRAFSLK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-NLKRAFSLK-OH at the technical inquiry form on this page</p>

<p>Peptide H-RASTIEMPQQAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-CDVFSVKTEMIDQEEGIS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Synthetic host defence peptide derivative with strong anti-inflammatory properties.</p>

<p>Peptide H-LLFGYPVYV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>