Bioquímicos e reagentes

<p>Please enquire for more information about Z-Ile-Trp-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Met-Met-OH is a dietary supplement that has been shown to have a variety of health benefits in animals. It has been shown to increase the production of tnf-α and other fatty acids, which are known to play a role in cellular physiology. H-Met-Met-OH also has the ability to inhibit protein synthesis and this is thought to be due to its transport properties as well as its reaction products. H-Met-Met-OH can be taken orally or given through explants, either orally or by injection.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Please enquire for more information about Boc-Cys(SO3H)-OH·disodium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Antifreeze Polypeptide 6 (AFP6) is a protein that belongs to the family of antifreeze proteins. AFP6 binds to ion channels and prevents the flow of ions, which prevents the formation of ice crystals. It also has been shown to interact with other proteins, such as receptors and peptides. This protein has been shown to be a research tool for studying cell biology and pharmacology. The CAS number for AFP6 is 122604-16-4.</p>

<p>H-Asp-NH2 is an isomeric mixture of l-phenylalanine and its methyl ester. It is used as a feed additive in animals to improve growth and feed conversion efficiency. The deamination of H-Asp-NH2 produces hydrogen peroxide, which has been shown to be lethal to enterobacteriaceae. This compound may also act as a microbial growth inhibitor by preventing the formation of peptides during synthesis.</p>

<p>PKI-tide is a potent, selective inhibitor of the calcium/calmodulin-dependent protein kinase. It inhibits the activity of this enzyme and prevents the activation of other protein kinases by this enzyme. PKI-tide binds to the ATP site of the calcium/calmodulin-dependent protein kinase and blocks the binding of ATP and calmodulin. This inhibition prevents the phosphorylation of target proteins, including myosin light chain in muscle cells.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>an orally active, reversible and selective CXCR4 (CD184, fusin) antagonist</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Custom research peptide; min purity 95%.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Diabzi sting agonist-1 is a biological molecule that is the tautomer of diabzol. It has been shown to have antifungal properties in vitro, and is shown to be effective against bowel disease when administered orally. Diabzi sting agonist-1 binds to fungal cell walls by hydrogen bonding interactions with nitrogen atoms on the pyrazole ring. This binding leads to protonation and conformational changes that lead to the release of bound form of the drug, which inhibits cellular growth. The redox potentials of this molecule are high enough for it to be used as an electron donor or acceptor.</p>

<p>JDQ-443 is a synthetic chemical compound, which is a product of organic synthesis, with a precise mode of action targeting specific cellular enzymes. This compound functions as an enzymatic inhibitor, designed to interfere with the activity of a specific class of enzymes critical to cellular proliferation pathways. JDQ-443 exerts its effects by binding to the active sites of these enzymes, thereby preventing substrate access and subsequent catalysis.</p>

<p>Anti-Human PCSK9 Monoclonal Antibody; 98%</p>

<p>nAChRs nicotinic receptor antagonist; neuromuscular-blocking agent</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Please enquire for more information about (Gly28,Cys30)-Amyloid b-Protein (1-30) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Please enquire for more information about H-Gly-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>A hepta-peptide first isolated from the skin of  South American frogs.  It binds as an agonist with high potency and selectivity to mu opioid receptors.  Dermorphin is not found in humans or other mammals.  It appears to be made in mammals through an unusual posttranslational modification carried out by an amino acid isomerase.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>CJC-1295-no DAC acetate is a synthetic peptide, which is a modified form of the growth hormone-releasing hormone (GHRH) analog, derived from recombinant sources. Its mode of action involves binding to the growth hormone secretagogue receptor, thereby promoting the release of growth hormone from the anterior pituitary. This mechanism of action facilitates the increase of circulating insulin-like growth factor 1 (IGF-1), enhancing various physiological processes.In scientific research, CJC-1295-no DAC acetate is primarily utilized to study its potential effects on muscle growth, body composition, and overall metabolic function. It is also used to explore its ability to modulate the aging process through growth hormone pathways. Unlike its counterpart with DAC, this variant has a shorter half-life, thus allowing researchers to examine the temporal effects of pulsatile GH release. Furthermore, its applications extend to understanding disorders related to growth hormone deficiencies, contributing valuable insights into therapeutic strategies for such conditions. The peptide serves as an important tool in endocrinology research, providing a platform for studying the complex interactions between hormonal regulation and physiological outcomes.DAC is 'drug affinity complex' and in this peptide works by not having a lysine at the end of the sequence.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Inhibitor of acetylcholinesterase</p>

<p>Please enquire for more information about ent-[Amyloid b-Protein (20-16)]-b-Ala-D-Lys(ent-[Amyloid b-Protein (16-20)]) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mca-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (667-676)-Lys(Dnp)-Arg-Arg amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Puromycin is an aminonucleoside antibiotic, derived from the bacterium Streptomyces albus, with its primary mode of action involving the inhibition of protein synthesis. During translation, puromycin mimics the aminoacyl end of tRNA, enabling its incorporation into the growing polypeptide chain within the ribosome. This incorporation disrupts further chain elongation, ultimately leading to premature termination of protein synthesis.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Please enquire for more information about Leishmania Infantum K39-LinJ Chimeric Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Anti-Human Nectin-4 Monoclonal Antibody</p>

<p>Please enquire for more information about H-DL-delta-Hydroxy-DL-Lys(Boc)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>SB743921 HCl is a synthetic small-molecule compound, which is a derivative of the well-known kinesin spindle protein (KSP) inhibitors. Originating from sophisticated medicinal chemistry, it acts by selectively binding to the KSP, a motor protein essential for the mitotic spindle formation during cell division.</p>

<p>Angiotensin I/II 1-6 is a peptide containing amino acids 1-6; derived from from Angiotensin I/II.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Trifluoroacetate salt</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>A carboxyl-terminal cleavage product of collagen 6 alpha-3 chain which is produced and released by adipocytes and massively upregulated in malignant tumors of breast, liver colon and pancreas. Endotrophin provides a link between obesity and aggressive tumor growth and may serve as sensitive diagnostic marker and valid therapeutic target for designing better strategies to treat cancer and ameliorate obesity-induced insulin resistance.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Please enquire for more information about Myelin Oligodendrocyte Glycoprotein (35-55) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Perfluorophenyl 19-(2,5-dioxo-2H-pyrrol-1(5H)-yl)-17-oxo-4,7,10,13-tetraoxa-16-azanonadecan-1-oate is a synthetic compound, which is derived through a series of complex organic syntheses involving perfluorinated reagents. This compound is meticulously designed to incorporate both perfluorinated aromatic groups and a flexible, polyether-based linker. The mode of action for this compound primarily revolves around its unique chemical structure, which facilitates interactions at the molecular level that can be favorable for a variety of biochemical applications.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Peptide H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Please enquire for more information about (D-His(Bzl)6)-LHRH (1-7) (free acid) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>15:0 Lyso PC is a lipid with a fatty acid backbone. It is found in the blood and tissue of mammals, such as humans and cows. 15:0 Lyso PC is produced by the liver, where it plays an important role in cholesterol metabolism. This lipid can be used as a diagnostic marker for chronic kidney disease and heart disease. It also has been shown to have a positive correlation with blood pressure levels. Hippuric acid is another potential diagnostic marker for cirrhosis diagnosis and prognosis.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Atorvastatin acid is a pharmaceutical compound belonging to the class of statins, which is a synthetic derivative of fungal metabolites. It functions as an HMG-CoA reductase inhibitor, playing a critical role in the cholesterol biosynthesis pathway. By inhibiting this key enzyme, atorvastatin acid effectively reduces the conversion of HMG-CoA to mevalonate, a precursor of cholesterol, thus lowering overall cholesterol levels in the bloodstream.</p>

<p>Please enquire for more information about (Lauroyl-Cys-Tyr-Gly(-Glu-Glu-Asn-Val)6-OH)2 (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Please enquire for more information about Z-D-Arg-Gly-Arg-pNA dihydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Please enquire for more information about (S)-1-(3-(4-Amino-3-(4-phenoxyphenyl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)piperidin-1-yl)prop-2-en-1-one including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>