Bioquímicos e reagentes

<p>Rabbit anti-mouse IgM was raised in rabbit using murine IgM mu heavy chain as the immunogen.</p>

<p>Mouse anti Rat IgM secondary antibody (HRP)</p>

<p>TRAF4 antibody was raised in rabbit using the middle region of TRAF4 as the immunogen</p>

<p>This antibody reacts with heavy chains on human IgA (alpha chain) and.</p>

<p>Tgfb1 antibody was raised in rabbit using the middle region of TGFB1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZDHHC14 antibody, catalog no. 70R-7047</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of INSIG1 antibody, catalog no. 70R-6612</p>

<p>Affinity purified Rabbit polyclonal PIK3R4 antibody</p>

<p>ADAMTS4 antibody was raised using the N terminal of ADAMTS4 corresponding to a region with amino acids GVQVEGLTVQYLGQAPELLGGAEPGTYLTGTINGDPESVASLHWDGGALL</p>

<p>NEK2 antibody was raised in Rabbit using Human NEK2 as the immunogen</p>

<p>Rabbit polyclonal APBA2 antibody</p>

<p>ARNTL antibody was raised in Mouse using a purified recombinant fragment of human ARNTL expressed in E. coli as the immunogen.</p>

<p>The UROD antibody is a highly specialized monoclonal antibody that has neutralizing properties against annexin A2. This antibody is colloidal in nature and is used in Life Sciences research to study the role of annexin A2 in various cellular processes. It has been shown to inhibit the activity of glucagon, a hormone involved in glucose metabolism. The UROD antibody specifically targets the amino-terminal region of annexin A2, which is activated under certain conditions. This monoclonal antibody can be used in experiments to investigate the function of annexin A2 and its potential as a therapeutic target for various diseases, including cardiomyocyte dysfunction and natriuretic factor regulation. Additionally, polyclonal antibodies targeting annexin A2 are also available for research purposes.</p>

<p>FZD9 antibody was raised in Rabbit using Human FZD9 as the immunogen</p>

<p>PTBP2 antibody was raised using the N terminal of PTBP2 corresponding to a region with amino acids AITMVNYYSAVTPHLRNQPIYIQYSNHKELKTDNTLNQRAQAVLQAVTAV</p>

<p>Rat monoclonal CD115 antibody (biotin)</p>

<p>INPP5A antibody was raised in Rabbit using Human INPP5A as the immunogen</p>

<p>Region of MIA2 protein corresponding to amino acids MLESTKLLAD LKKCGDLECE ALINRVSAMR DYRGPDCRYL NFTKGEEISV YVKLAGERED LWAGSKGKEF GYFPRDAVQI EEVFISEEIQ MSTKESDFLC L.</p>

<p>CD4 antibody (PE) was raised in mouse using chicken CD4 as the immunogen</p>

<p>The CD4 antibody is a monoclonal antibody that specifically targets the CD4 antigen. This antibody is widely used in life sciences research to study the role of CD4 in various biological processes. The CD4 antigen is a glycoprotein found on the surface of T-helper cells, and it plays a crucial role in immune system regulation.</p>

<p>The Cyclin H antibody is a highly specific monoclonal antibody that is used in Life Sciences research. It has been extensively tested and validated for its performance in various applications. This antibody is designed to target the cyclin H protein, which plays a crucial role in cell cycle regulation and growth factor signaling pathways.</p>

<p>The Canine Coronavirus protein is a protein complex that is found in human serum. It is used in the field of Life Sciences for various purposes, including research and diagnostics. This protein complex can be used as a tool to study the interaction between viruses and host cells, as well as to develop inhibitors and monoclonal antibodies for therapeutic use. The Canine Coronavirus protein has also been shown to have viscosity-enhancing properties, which makes it useful in applications such as the measurement of creatine kinase levels in blood samples. Additionally, this protein complex can be used as a growth factor and has been found to form dimers with other proteins such as chemokines and interleukin-6. Overall, the Canine Coronavirus protein is a versatile tool that plays a crucial role in understanding and advancing our knowledge in the field of Life Sciences.</p>

<p>PPP1R13L antibody was raised in mouse using recombinant Human Protein Phosphatase 1, Regulatory (Inhibitor) Subunit 13 Like (Ppp1R13L)</p>

<p>Rabbit polyclonal PGM2L1 antibody</p>

<p>MMD2 antibody was raised using the N terminal of MMD2 corresponding to a region with amino acids FAPRLLDFQKTKYARFMNHRVPAHKRYQPTEYEHAANCATHAFWIIPSIL</p>

<p>RUNX3 antibody was raised in rabbit using the C terminal of RUNX3 as the immunogen</p>

<p>MCART6 antibody was raised using the middle region of MCART6 corresponding to a region with amino acids WPVLARNSLGSALYFSFKDPIQDGLAEQGLPHWVPALVSGSVNGTITCLV</p>

<p>Rabbit polyclonal PTK6 antibody</p>

<p>Mouse monoclonal PRS3 antibody</p>

<p>IL11R alpha antibody was raised using the middle region of IL11RA corresponding to a region with amino acids FLLKFRLQYRPAQHPAWSTVEPAGLEEVITDAVAGLPHAVRVSARDFLDA</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ALS2CR12 antibody, catalog no. 70R-3279</p>

<p>The ITGB4 antibody is a highly specialized biomolecule that acts as an inhibitor of growth factors. It specifically targets nuclear and nucleotide molecules, preventing them from activating certain cellular processes. This monoclonal antibody has been shown to have a high affinity for the tyrosine residues on the surface of cells, effectively blocking their interaction with growth factor receptors.</p>

<p>ERCC5 antibody was raised in Rabbit using Human ERCC5 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of OR2D3 antibody, catalog no. 70R-9860</p>

<p>Rabbit polyclonal AQP12 antibody</p>

<p>Mouse monoclonal RXRG antibody</p>

<p>FXYD5 antibody was raised using the middle region of FXYD5 corresponding to a region with amino acids DETPQPQTQTQQLEGTDGPLVTDPETHKSTKAAHPTDDTTTLSERPSPST</p>

<p>Mouse monoclonal PPARA antibody</p>

<p>CYP27A1 antibody was raised in Rabbit using Human CYP27A1 as the immunogen</p>

<p>Licoflavone A is a natural sweetener with inhibitory activity against bacteria, fungi and viruses. It has been shown to have an activity index of 0.7-0.8. Licoflavone A inhibits the growth of many bacteria such as Staphylococcus aureus, Escherichia coli, Streptococcus pneumoniae, Klebsiella pneumoniae, Salmonella enterica and Pseudomonas aeruginosa by binding to the enzyme PTP1B. The compound also inhibits phosphatase activity in echinatin and glycyrrhiza species and has been found to be active against influenza virus in vitro. Licoflavone A displays antioxidant properties by inhibiting lipid peroxidation in cells treated with hydrogen peroxide or other reactive oxygen species (ROS).</p>

<p>MBD1 antibody was raised using the middle region of MBD1 corresponding to a region with amino acids CKVWETEDTVEPTSTSWNPRGWPGTHVSLSPPPASMMWVSCRRSWCPSSQ</p>

<p>Purified recombinant MRM1 protein (His tag)</p>

<p>CCBL1 antibody was raised in Rabbit using Human CCBL1 as the immunogen</p>

<p>Rabbit polyclonal EIF3S2 antibody</p>

<p>Rabbit polyclonal RPL9 antibody</p>

<p>The ROCK2 antibody is a protein that has neutralizing properties against collagen. It belongs to the class of polyclonal antibodies and is used in Life Sciences research. This antibody specifically targets ROCK2, which stands for Rho-associated coiled-coil containing protein kinase 2. ROCK2 is involved in various cellular processes, including cell proliferation, migration, and contraction. The ROCK2 antibody can be used for various applications such as immunohistochemistry, Western blotting, and enzyme-linked immunosorbent assays (ELISAs). It is available in both monoclonal and polyclonal forms. The antibody can be immobilized on chromatographic resins or used for protein-protein interaction studies. Additionally, it can be used to study the role of ROCK2 in hepatocyte growth factor signaling pathways or to investigate its binding partners such as angptl3 or growth factor binding proteins.</p>

<p>Rabbit polyclonal TNFAIP8 antibody</p>

<p>Purified Polyclonal Cytochrome P450 3A4 antibody</p>

<p>Rabbit polyclonal JunD antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of COMT antibody, catalog no. 70R-7143</p>

<p>PAPOLB antibody was raised using the middle region of PAPOLB corresponding to a region with amino acids MEEFRTMWVIGLGLKKPDNSEILSIDLTYDIQSFTDTVYRQAVNSKMFEM</p>

<p>USP38 antibody was raised in rabbit using the middle region of USP38 as the immunogen</p>

<p>The HA Tag antibody is a highly specific monoclonal antibody that is widely used in Life Sciences research. It is designed to specifically bind to the HA (hemagglutinin) epitope, which is commonly fused to target molecules for various applications. The HA Tag antibody is commonly used in immunoassays and antigen binding experiments to detect and quantify the expression of target proteins.</p>

<p>The TRPV4 antibody is a highly specialized monoclonal antibody that targets the transient receptor potential vanilloid 4 (TRPV4) channel. This channel plays a crucial role in various physiological processes, including natriuretic regulation, fibrinogen production, and cellular response to mechanical stress. The TRPV4 antibody has been extensively tested in human serum and has shown excellent specificity and sensitivity in detecting TRPV4 expression.</p>

<p>LRRC2 antibody was raised using the N terminal of LRRC2 corresponding to a region with amino acids GHKVVVFDISVIRALWETRVKKHKAWQKKEVERLEKSALEKIKEEWNFVA</p>

<p>PSMC6 antibody was raised in rabbit using the C terminal of PSMC6 as the immunogen</p>

<p>The EDNRA antibody is a polyclonal antibody that has been extensively studied and widely used in various applications. It is commonly used in CDNA microarray experiments to analyze gene expression profiles and identify potential biomarkers. The EDNRA antibody specifically targets the endothelin receptor type A (EDNRA), which plays a crucial role in cellular immunotherapy and the development of targeted therapies for various diseases.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known to effectively treat tuberculosis infections due to its bactericidal activity. This active compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its high frequency of human activity has been demonstrated using a patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>HEPACAM antibody was raised in Rabbit using Human HEPACAM as the immunogen</p>

<p>FGF10 antibody was raised in goat using highly pure recombinant human FGF-10 as the immunogen.</p>

<p>The WNT16 antibody is a highly reactive polyclonal and monoclonal antibody that specifically binds to antigen binding molecules. It has been extensively studied in the field of Life Sciences for its role in various biological processes. The WNT16 antibody has shown to inhibit the activity of phosphatase, interleukin-6, and cysteine-rich proteins, which are involved in important cellular signaling pathways. Additionally, it has been found to exhibit cytotoxic effects on human serum and can block the transmembrane conductance of certain chemokines. With its high specificity and potent inhibitory properties, the WNT16 antibody is a valuable tool for researchers studying activated signaling pathways and exploring potential therapeutic targets.</p>

<p>The p35 antibody is a monoclonal antibody that is widely used in the field of Life Sciences. It specifically targets actin filaments and has been extensively studied for its role in various cellular processes. This antibody has shown high specificity and affinity towards actin, making it an essential tool for researchers studying actin dynamics and cytoskeletal organization.</p>

<p>The TUBA1C antibody is a hormone peptide that acts as an inhibitory factor. It is a cytotoxic antibody that targets antiphospholipid antibodies in the human serum. This monoclonal antibody has been shown to inhibit the activity of interferon, dopamine, and leukemia inhibitory factor. Additionally, it has been found to possess anticoagulant properties. The TUBA1C antibody is a highly specific and potent inhibitor that can be used in various research and clinical applications. Its unique characteristics make it an essential tool for studying autoimmune disorders and developing targeted therapies.</p>

<p>Rabbit polyclonal CCDC102A antibody</p>

<p>The SPIC antibody is a highly specialized polyclonal antibody that targets endothelial growth factor. It is commonly used in the field of Life Sciences for research purposes. This antibody specifically binds to tyrosine residues on the endothelial growth factor, neutralizing its activity and preventing further growth stimulation. The SPIC antibody has shown promising results in inhibiting the growth of various types of cells, including those expressing the circumsporozoite protein and glucagon receptors. Additionally, it exhibits neurotrophic and neuroprotective effects, making it a valuable tool for studying neuronal development and regeneration. With its high specificity and affinity, the SPIC antibody is an essential component in many research projects focused on understanding growth factors and their role in various biological processes.</p>

<p>CD3e antibody was raised in rat using CD3e as the immunogen.</p>

<p>The SIAH1 Blocking Peptide is a high-quality product offered by Life Sciences. This peptide is commonly used in the field of Peptides and Biochemicals for its exceptional ability to neutralize TGF-beta in human serum. It contains a unique disulfide bond structure that ensures its stability and effectiveness.</p>

<p>Rotavirus grade 3 Antigen. Taxonomy: Rheoviridae/Rotavirus/Rotavirus A/Simian rotavirus SA11. Virions consist of a capsid, a core, and a nucleoprotein complex. Virus capsid is not enveloped. Capsid/nucleocapsid is isometric with icosahedral symmetry and has a diameter of 80 nm. The genome is segmented and consists of eleven segments of linear double-stranded RNA. Rotavirus is the most common cause of severe diarrhea among children.</p>

<p>HPDL antibody was raised in Rabbit using Human HPDL as the immunogen</p>

<p>RAVER1 antibody was raised using the middle region of RAVER1 corresponding to a region with amino acids ALLQLALQTQGQKKPGILGDSPLGALQPGAQPANPLLGELPAGGGLPPEL</p>

<p>This antibody reacts with heavy chains on human IgG (gamma chain).</p>

<p>Mouse monoclonal NDUFB9 antibody</p>

<p>Syntrophin Gamma 1 antibody was raised using the middle region of SNTG1 corresponding to a region with amino acids RFSQYVPGTDLSRQNAFQVIAVDGVCTGIIQCLSAEDCVDWLQAIATNIS</p>

<p>This antibody reacts with kappa light chains on human immunoglobulins.</p>

<p>Mouse monoclonal CD19 antibody (biotin)</p>

<p>The CD3E antibody is a mouse monoclonal antibody that specifically targets the CD3E protein. This antibody has phosphatase activity and can be used for cytotoxic assays. It works by binding to the CD3E antigen on the surface of cells, leading to an antigen-antibody reaction. The CD3E antibody is commonly used in research and diagnostic applications, such as immunoassays and delta-9-tetrahydrocannabinol detection methods. It is buffered for stability and can be used with other antibodies, including polyclonal antibodies, to enhance detection sensitivity. This monoclonal antibody is widely used in life sciences research and has been validated for use in various applications, including flow cytometry, immunohistochemistry, and Western blotting. Its high affinity for the CD3E protein makes it a valuable tool for studying immune responses and cell signaling pathways.</p>

<p>GSK 2256294A is a diazonium salt that is used to treat bowel diseases. It has been shown to inhibit the production of fatty acid metabolites, such as epoxyeicosatrienoic acids (EETs), and reduce the number of autophagy-positive cells in diabetic patients. This molecule also has cancer-fighting properties and can be used to treat various types of cancers, including colon cancer, breast cancer, and prostate cancer. GSK 2256294A is currently undergoing preclinical studies for treatment of inflammatory bowel disease, cardiovascular disease, and liver disease.</p>

<p>Rabbit polyclonal RPL28 antibody</p>

<p>The LTA4H antibody is a monoclonal antibody that is used in the field of Life Sciences. It is designed to target and bind to LTA4H, an enzyme involved in the metabolism of fatty acids. This antibody has a low density and is highly specific, making it an ideal tool for research and diagnostic purposes. The LTA4H antibody can be used in various applications, including immunoassays, Western blotting, immunohistochemistry, and flow cytometry. It is produced using advanced nanocomposite technology, which ensures high purity and stability. This antibody is supplied with all necessary excipients and can be easily activated for use in different experimental setups. In addition to its research applications, the LTA4H antibody has also shown potential as an antiviral agent against certain viral infections.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KLHDC9 antibody, catalog no. 70R-4006</p>

<p>OMA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids WAICPRDSLALLCQWIQSKLQEYMFNRPYSRKLEAEADKIGLLLAAKACA</p>

<p>PRRG2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RCSWEEAREYFEDNTLTERFWESYIYNGKGGRGRVDVASLAVGLTGGILL</p>

<p>The MMP7 antibody is a polyclonal antibody that belongs to the category of Life Sciences. It is specifically designed to target and neutralize the activity of matrix metalloproteinase 7 (MMP7). This antibody has been shown to be highly effective in inhibiting the activation of fibrinogen and potassium channels, which are crucial for various biological processes. The MMP7 antibody is produced from hybridoma cells, ensuring its high specificity and potency. It can be used as a medicament for treating diseases associated with abnormal MMP7 activity, such as cancer, inflammatory disorders, and cardiovascular diseases. Additionally, this antibody has been found to have neutralizing effects on chemokines and growth factors, further highlighting its therapeutic potential. With its exceptional binding affinity to MMP7 and its ability to block key enzymatic activities, the MMP7 antibody is a valuable tool in research and clinical applications related to protease biology and disease mechanisms.</p>

<p>Complement C8b antibody was raised using the middle region of C8B corresponding to a region with amino acids WKPGSSGPGSTGSWNSGSSGTGSTGNQNPGSPRPGSTGTWNPGSSERGSA</p>

<p>Rabbit polyclonal EGR1/2 antibody</p>

<p>Region of FGF acidic protein corresponding to amino acids MFNLPLGNYK KPKLLYCSNG GHFLRILPDG TVDGTRDRSD QHIQLQLSAE SAGEVYIKGT ETGQYLAMDT EGLLYGSQTP NEECLFLERL EENHYNTYTS KKHAEKNWFV GLKKNGSCKR GPRTHYGQKA ILFLPLPVSS D.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SIRT7 antibody, catalog no. 70R-7917</p>

<p>MGAT3 antibody was raised in Rabbit using Human MGAT3 as the immunogen</p>

<p>OXTR antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>The CD248 antibody is a monoclonal antibody that specifically targets and binds to the CD248 protein. This protein is also known as endosialin or tumor endothelial marker 1 (TEM1). CD248 is activated by calpain and taxol inhibitors, and it plays a crucial role in various biological processes, including cell adhesion, migration, and angiogenesis.</p>

<p>MCP1 antibody was raised in Mouse using a purified recombinant fragment of human MCP-1 expressed in E. coli as the immunogen.</p>

<p>Mouse monoclonal 160 kDa Neurofilament antibody</p>

<p>PP2Calpha antibody was raised in mouse using recombinant human PP2Calpha (1-382aa) purified from E. coli as the immunogen.</p>

<p>RAB3IL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PTVKVAEVDCSSTNTCALSGLTRTCRHRIRLGDSKSHYYISPSSRARITA</p>

<p>Purified recombinant VCAP18/GP125 fusion protein</p>

<p>NAPE-PLD antibody was raised using the N terminal Of Nape-Pld corresponding to a region with amino acids TWKNPSIPNVLRWLIMEKDHSSVPSSKEELDKELPVLKPYFITNPEEAGV</p>

<p>The SHP1 antibody is a powerful tool used in the field of life sciences. It belongs to the category of multidrug antibodies and has been extensively studied for its role in various biological processes. This antibody specifically targets androgen, collagen, interferon, hepatocyte growth factor, chemokines, growth factors, and inhibitors.</p>

<p>FAM113A antibody was raised using the N terminal of FAM113A corresponding to a region with amino acids VLLLQKDSLLTAAQLKAKGELSFEQDQLVAGGQLGELHNGTQYREVRQFC</p>

<p>Rabbit polyclonal Caspase 9 antibody (Ser196)</p>

<p>Rabbit polyclonal PTGS1 antibody</p>