Bioquímicos e reagentes

<p>Rabbit polyclonal RBM16 antibody</p>

<p>FOLH1 antibody was raised in Rabbit using Human FOLH1 as the immunogen</p>

<p>Rabbit polyclonal RPS13 antibody</p>

<p>Rabbit polyclonal TRAM2 antibody</p>

<p>IRX3 antibody was raised in rabbit using the C terminal of IRX3 as the immunogen</p>

<p>TSHR antibody was raised using the N terminal of TSHR corresponding to a region with amino acids LTLKLYNNGFTSVQGYAFNGTKLDAVYLNKNKYLTVIDKDAFGGVYSGPS</p>

<p>Transferrin antibody was raised in mouse using purified transferrin from pooled human plasma as the immunogen.</p>

<p>Purified recombinant Human TREX2 protein</p>

<p>BRAP antibody was raised using the middle region of BRAP corresponding to a region with amino acids YLETQQKINHLPAETRQEIQEGQINIAMASASSPASSGGSGKLPSRKGRS</p>

<p>GPRC5B antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>CHTF18 antibody was raised using a synthetic peptide corresponding to a region with amino acids SLVGTMLAYSLTYRQERTPDGQYIYRLEPNVEELCRFPELPARKPLTYQT</p>

<p>Cyyr1 antibody was raised in rabbit using the middle region of Cyyr1 as the immunogen</p>

<p>LPP antibody was raised using the N terminal of LPP corresponding to a region with amino acids GKTLEERRSSLDAEIDSLTSILADLECSSPYKPRPPQSSTGSTASPPVST</p>

<p>Rabbit Polyclonal TNFRSF5 antibody (Thr254)</p>

<p>alpha, beta Synuclein antibody was raised in mouse using recombinant human a-synuclein (119-140aa) purified from E. coli as the immunogen.</p>

<p>DYSF antibody was raised using a synthetic peptide corresponding to a region with amino acids SRILDESEDTDLPYPPPQREANIYMVPQNIKPALQRTAIEILAWGLRNMK</p>

<p>Purified Polyclonal Creatine Kinase M antibody</p>

<p>Mouse monoclonal QPRT antibody</p>

<p>RBMS3 antibody was raised using the middle region of RBMS3 corresponding to a region with amino acids TYIPQYTPVPPTAVSIEGVVADTSPQTVAPSSQDTSGQQQQIAVDTSNEH</p>

<p>The ROD1 antibody is a neutralizing antibody that belongs to the category of polyclonal antibodies. It is used in life sciences research to study the role of interleukins and other growth factors. This antibody specifically targets nuclear binding proteins and can be used in various assays and experiments. Whether you need a monoclonal or polyclonal version, the ROD1 antibody is an essential tool for researchers looking to study the effects of specific proteins or develop new drug antibodies. With its high specificity and reliability, this antibody is a valuable addition to any laboratory's toolkit.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PPP2R3B antibody, catalog no. 70R-5584</p>

<p>FBP2 antibody was raised using the middle region of FBP2 corresponding to a region with amino acids YIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQ</p>

<p>Affinity purified Rabbit polyclonal TCP1 epsilon antibody</p>

<p>Chromogranin A antibody was raised using a synthetic peptide corresponding to a region with amino acids DSLEAGLPLQVRGYPEEKKEEEGSANRRPEDQELESLSAIEAELEKVAHQ</p>

<p>Turkey RBC antibody (FITC) was raised in rabbit using turkey erythrocytes as the immunogen.</p>

<p>Closantel Conjugate for use in immunoassays</p>

<p>The RELB antibody is a powerful cytotoxic agent that targets specific proteins in the body. It is a monoclonal antibody that has been extensively studied in the field of Life Sciences. The RELB antibody has shown to have a high affinity for transferrin, anti-ACTH antibodies, insulin, fibronectin, and collagen. It has also been found to inhibit the activity of various growth factors such as epidermal growth factor and HER2. This antibody can be used in research settings to study the effects of these proteins on cell function and signaling pathways. Additionally, it has potential therapeutic applications in the treatment of diseases associated with abnormal protein expression or function.</p>

<p>ARMC8 antibody was raised in rabbit using the N terminal of ARMC8 as the immunogen</p>

<p>Tat antibody was raised in rabbit using the C terminal of Tat as the immunogen</p>

<p>Purified Polyclonal COX7A2L antibody</p>

<p>MAGE-A3 (112-120) peptide – KVAELVHFL – Epitope of Melanoma Antigen Gene A3</p>

<p>24-423 amino acids: MGSSHHHHHH SSGLVPRGSH MHPNSPLDEE NLTQENQDRG THVDLGLASA NVDFAFSLYK QLVLKAPDKN VIFSPLSIST ALAFLSLGAH NTTLTEILKG LKFNLTETSE AEIHQSFQHL LRTLNQSSDE LQLSMGNAMF VKEQLSLLDR FTEDAKRLYG SEAFATDFQD SAAAKKLIND YVKNGTRGKI TDLIKDLDSQ TMMVLVNYIF FKAKWEMPFD PQDTHQSRFY LSKKKWVMVP MMSLHHLTIP YFRDEELSCT VVELKYTGNA SALFILPDQD KMEEVEAMLL PETLKRWRDS LEFREIGELY LPKFSISRDY NLNDILLQLG IEEAFTSKAD LSGITGARNL AVSQVVHKAV LDVFEEGTEA SAATAVKITL LSALVETRTI VRFNRPFLMI IVPTDTQNIF FMSKVTNPKQ A</p>

<p>PDX1 antibody was raised in rabbit using the N terminal of Pdx1 as the immunogen</p>

<p>Rabbit anti-goat IgG (H + L) (HRP) was raised in rabbit using goat IgG whole molecule as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of B4GALNT1 antibody, catalog no. 70R-7378</p>

<p>MAPK12 antibody was raised using the N terminal of MAPK12 corresponding to a region with amino acids SGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHE</p>

<p>Mouse monoclonal NSMCE2 antibody</p>

<p>Purified recombinant Human MAGEA3 protein</p>

<p>WZ8040 is a factor receptor inhibitor that blocks the epidermal growth factor receptor (EGFR) family of tyrosine kinase receptors. It is an inhibitor of the EGFR family of tyrosine kinases and has been shown to inhibit proliferation in vitro and in vivo. WZ8040 also inhibits the activation of downstream signaling pathways, including ERK, AKT, and STAT3, which regulate cell survival and proliferation. This drug has been shown to be effective against bladder cancer cells with wild-type EGFR but not those that are resistant to quinazoline-based drugs such as PD168393 or pelitinib.</p>

<p>The FGFR4 antibody is a highly specialized chemotherapy agent used in the field of Life Sciences. It belongs to the class of Polyclonal Antibodies and is known for its toxic effects on targeted cells. This antibody specifically targets growth factor receptors, inhibiting their activity and preventing cell proliferation. It can be used as a monoclonal antibody or in combination with other inhibitors or sequestrants to enhance its therapeutic effects. The FGFR4 antibody has been extensively studied as a test substance in various research studies, demonstrating its efficacy in blocking the extracellular signaling pathways involved in cell growth and development. Its unique ability to bind to specific polynucleotides makes it an excellent inhibitor for targeted therapy.</p>

<p>The GPRC5B antibody is a monoclonal antibody that targets the G protein-coupled receptor family C group 5 member B. This antibody plays a crucial role in various biological processes, including adipose tissue regulation and natriuretic responses. It can be used in research and diagnostic assays to detect the expression of GPRC5B in different tissues and cell types.</p>

<p>Affinity purified Rabbit polyclonal Surfactant Protein A antibody</p>

<p>The BAX antibody is a highly effective tool for researchers in the field of Life Sciences. It is available as both polyclonal and monoclonal antibodies, allowing for versatile applications in various experimental settings.</p>

<p>The CD27 antibody is a monoclonal antibody that specifically targets the CD27 antigen. It is widely used in research and clinical applications for its ability to detect and neutralize CD27, a protein expressed on the surface of activated human B cells and T cells. This antibody has been extensively studied and proven to be highly effective in various experimental settings. It can be used in techniques such as immunohistochemistry, flow cytometry, and Western blotting to study the expression and function of CD27. Additionally, the CD27 antibody has shown potential therapeutic applications, particularly in cancer treatment, where it has been combined with other agents like taxol or albumin nanocomposites to enhance its efficacy. Its neutralizing properties also make it a promising candidate for the development of treatments against botulinum toxin. With its high specificity and reliability, the CD27 antibody is an essential tool for researchers and clinicians alike in their pursuit of understanding immune responses and developing novel therapies.</p>

<p>Rabbit polyclonal NFKP p100/p52 antibody (Ser865)</p>

<p>HSP70 antibody was raised in Rabbit using Human HSP70 as the immunogen</p>

<p>FLJ37300 antibody was raised using the N terminal Of Flj37300 corresponding to a region with amino acids EVSMSYLEIYNEMIRDLLNPSLGYLELREDSKGVIQVAGITEVSTINAKE</p>

<p>Rabbit polyclonal ZNF592 antibody (HRP)</p>

<p>GJA4 antibody was raised using the middle region of GJA4 corresponding to a region with amino acids QKEGELRALPAKDPQVERALAAVERQMAKISVAEDGRLRIRGALMGTYVA</p>

<p>CCDC87 antibody was raised using the N terminal of CCDC87 corresponding to a region with amino acids MMEPPKPEPELQRFYHRLLRPLSLFPTRTTSPEPQKRPPQEGRILQSFPL</p>

<p>Mouse monoclonal CD79a antibody (FITC)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NUDC antibody, catalog no. 70R-5520</p>

<p>Rabbit polyclonal Zap 70 antibody</p>

<p>KIF5A antibody was raised in Rabbit using Human KIF5A as the immunogen</p>

<p>The Apolipoprotein A1 antibody is a polyclonal antibody that specifically targets and binds to apolipoprotein A1, a protein involved in lipid metabolism. This antibody is widely used in life sciences research to study the functions and interactions of apolipoprotein A1 in various biological processes.</p>

<p>CD104 antibody was raised in rat using tumor-associated antigen TSP-180 immunoaffinity purified from a transplantable BALB/c mouse lung cell carcinoma as the immunogen.</p>

<p>The PFKL antibody is an activated antibody that specifically targets the racemase enzyme. It is commonly used in Life Sciences research and assays to study the role of this enzyme in various biological processes. The PFKL antibody is available as both a polyclonal antibody and a monoclonal antibody, providing researchers with options for their specific experimental needs. This antibody can be used for a range of applications, including immunohistochemistry, Western blotting, and ELISA. Its high specificity and sensitivity make it a valuable tool for detecting and quantifying the presence of racemase in samples such as human serum or extracellular fluids. Additionally, the PFKL antibody can be used in combination with other cytotoxic inhibitors or antibodies to study complex signaling pathways or protein interactions. Whether you are conducting basic research or developing new diagnostic tools, the PFKL antibody is an essential component for your experiments.</p>

<p>The CHD1L antibody is a polyclonal antibody that targets the growth factor CHD1L. It can be used in various applications, including insulin antibody assays and as a research tool for studying the role of CHD1L in different biological processes. This antibody has also been used in combination with other antibodies, such as trastuzumab, to detect specific proteins or biomarkers in samples. Additionally, it has shown reactivity with thymidylate synthase and anti-HER2 antibodies in human serum, making it a valuable tool for diagnostic purposes. The CHD1L antibody can be used in both monoclonal and polyclonal forms, offering flexibility for different experimental setups. Its specificity towards glial fibrillary acidic protein (GFAP) makes it particularly useful for studying autoimmune diseases or neurological disorders involving GFAP autoantibodies. Researchers can rely on this antibody to provide accurate and reliable results in their investigations.</p>

<p>KIR2DL4 antibody was raised using the middle region of KIR2DL4 corresponding to a region with amino acids VSVTGNPSSSWPSPTEPSFKTGIARHLHAVIRYSVAIILFTILPFFLLHR</p>

<p>IL4 antibody was raised in mouse using recombinant human IL-4 as the immunogen.</p>

<p>Mouse monoclonal PYCRL antibody</p>

<p>Rabbit polyclonal MIF antibody (biotin)</p>

<p>MTRF1L antibody was raised using the N terminal of MTRF1L corresponding to a region with amino acids MRSRVLWGAARWLWPRRAVGPARRPLSSGSPPLEELFTRGGPLRTFLERQ</p>

<p>Rabbit polyclonal GPR173 antibody</p>

<p>Mouse monoclonal CD3 antibody (FITC)</p>

<p>PIGT antibody was raised using the N terminal of PIGT corresponding to a region with amino acids PLPSGDVAATFQFRTRWDSELQREGVSHYRLFPKALGQLISKYSLRELHL</p>

<p>TNF beta antibody was raised in rabbit using highly pure recombinant human TNF-beta as the immunogen.</p>

<p>LRRC23 antibody was raised using the N terminal of LRRC23 corresponding to a region with amino acids LEVKERDLTDIYLLRSYIHLRYVDISENHLTDLSPLNYLTHLLWLKADGN</p>

<p>Rabbit polyclonal PCYT2 antibody</p>

<p>Rabbit polyclonal DYR1B antibody</p>

<p>LRRC8E antibody was raised using the middle region of LRRC8E corresponding to a region with amino acids LRELKQLKVLSLRSNAGKVPASVTDVAGHLQRLSLHNDGARLVALNSLKK</p>

<p>Rabbit polyclonal MECP2 antibody (Ser80)</p>

<p>Rabbit polyclonal Daxx antibody (Ser668)</p>

<p>The MCPH1 antibody is a highly specialized antibody that targets the protein MCPH1. This protein plays a crucial role in various biological processes, including collagen synthesis, phosphorylation site regulation, and antinociceptive activity. The MCPH1 antibody is widely used in Life Sciences research to study the function and regulation of this protein.</p>

<p>Mouse monoclonal PDE6G antibody</p>

<p>NFKB P52 antibody was raised in rabbit using human NFKB2 p52/p100 peptide corresponding to residues 1-19 of the human protein conjugated to KLH as the immunogen.</p>

<p>PTGS1 antibody was raised using the middle region of PTGS1 corresponding to a region with amino acids GFTKALGHGVDLGHIYGDNLERQYQLRLFKDGKLKYQVLDGEMYPPSVEE</p>

<p>Mouse monoclonal RNH1 antibody</p>

<p>ZNF226 antibody was raised in rabbit using the middle region of ZNF226 as the immunogen</p>

<p>S100PBP antibody was raised using the middle region of S100PBP corresponding to a region with amino acids ERRLGKVIPVLQTKTRTNVPTFSQSNLEQQKQLYLRSVIAHIEDPEDTNQ</p>

<p>Troponin T antibody (cardiac) was raised in mouse using free human cTnT as the immunogen.</p>

<p>The GLP1R antibody is a peptide nucleic acid that specifically binds to GLP-1 receptor (GLP1R) binding proteins. It is a polyclonal antibody commonly used in Life Sciences research. This antibody has been shown to block the activation of factor-α, a key mediator of inflammation. Additionally, it has been demonstrated to enhance the natriuretic response in animal models. The GLP1R antibody can be used in various experimental techniques such as electrode assays, botulinum toxin studies, and β-catenin signaling analysis. This high-quality antibody is produced using state-of-the-art technology and undergoes rigorous quality control testing to ensure optimal performance. Order now and unlock new insights into GLP-1 receptor biology.</p>

<p>MAGEA4 antibody was raised in Rabbit using Human MAGEA4 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SPATA12 antibody, catalog no. 70R-9013</p>

<p>The SERCA1 antibody is a highly specialized antibody that plays a crucial role in nitrogen metabolism. It belongs to the class of imidazolidine derivatives and has neutralizing properties. This antibody is used in various research applications, including the development of monoclonal antibodies for targeted therapies. It has been shown to inhibit the activity of TNF-α (tumor necrosis factor-alpha), a growth factor involved in inflammation and immune response. Additionally, the SERCA1 antibody has been found to interact with other proteins such as usnic acid and the rubisco enzyme, further highlighting its versatility and potential applications. Polyclonal Antibodies specific to SERCA1 are also available, providing researchers with a comprehensive toolset for their studies. Furthermore, this antibody has shown interactions with cyanobacterial proteins, interleukin-6, hepcidin, and parathyroid hormone-related peptide, suggesting its involvement in various biological processes and signaling pathways. With its wide range of applications and potential therapeutic</p>

<p>Mouse monoclonal HIBCH antibody</p>

<p>PPP2R3B antibody was raised using a synthetic peptide corresponding to a region with amino acids ELSDWEKYAAEEYDILVAEETAGEPWEDGFEAELSPVEQKLSALRSPLAQ</p>

<p>Rabbit polyclonal AROS antibody (biotin)</p>

<p>The p70S6 Kinase antibody is a powerful tool used in scientific research to study various cellular processes. This antibody specifically targets and binds to p70S6 Kinase, a protein involved in cell growth and proliferation. By binding to this protein, the antibody allows researchers to visualize and analyze its activity within cells.</p>

<p>Mouse Anti Mullerian Hormone antibody</p>

<p>Inflachromene is a molecule that is structurally related to the triterpenoid saponins. It has been found to have immunomodulatory effects on microglia, and it has been suggested that this may be due to its ability to induce autophagy. Inflachromene has also been found to stabilize chemical bonds by forming disulfide bonds, which can be used in sample preparation for analysis. The stability of inflachromene was observed in cell cultures as well as in human liver samples. The molecule has also been shown to have an effect on toll-like receptors (TLRs) and may be an effective treatment for autoimmune diseases such as multiple sclerosis.</p>

<p>Rat monoclonal CD117 antibody (FITC)</p>

<p>The FOXO4 antibody is a monoclonal antibody that specifically targets the protease FOXO4. This protease plays a crucial role in extracellular processes and has been implicated in various diseases. The FOXO4 antibody binds to the protease, inhibiting its activity and preventing it from carrying out its normal functions.</p>

<p>Rabbit polyclonal MAD4 antibody</p>

<p>AK2 antibody was raised using the middle region of AK2 corresponding to a region with amino acids LIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHT</p>

<p>NDUFS7 antibody was raised in Rabbit using Human NDUFS7 as the immunogen</p>

<p>GALNT7 antibody was raised in Rabbit using Human GALNT7 as the immunogen</p>

<p>CYP2F1 antibody was raised in Rabbit using Human CYP2F1 as the immunogen</p>

<p>B4GALT2 antibody was raised using the middle region of B4GALT2 corresponding to a region with amino acids NRISLTGMKISRPDIRIGRYRMIKHDRDKHNEPNPQRFTKIQNTKLTMKR</p>

<p>Goat anti-rat IgG (Fab'2) (Rhodamine) was raised in goat using rat IgG F(ab')2 fragment as the immunogen.</p>