Bioquímicos e reagentes

<p>ISG20 antibody was raised using the middle region of ISG20 corresponding to a region with amino acids TSTDRLLWREAKLDHCRRVSLRVLSERLLHKSIQNSLLGHSSVEDARATM</p>

<p>The CD11a antibody is a monoclonal antibody that specifically targets CD11a, a protein expressed on the surface of certain cells in the immune system. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications. It has been used to detect CD11a expression in human serum samples and to study its interaction with other molecules, such as TNF-α. The CD11a antibody has also been employed in neuroprotective studies, where it has demonstrated its ability to protect neurons from cytotoxic effects. In addition, this antibody has been utilized in electrode-based assays for hybridization and detection purposes. Its high affinity and specificity make it an ideal tool for researchers working in the field of immunology and cell biology.</p>

<p>The PR antibody is a highly specialized product in the field of Life Sciences. It is an antibody that specifically targets and interacts with alpha-fetoprotein, a growth factor found in human serum. This antibody has been shown to have cytotoxic effects on cells expressing alpha-fetoprotein, making it a valuable tool for research and diagnostics.</p>

<p>The CD4 antibody is a highly specific monoclonal antibody that targets the CD4 protein, which is found on the surface of certain immune cells. This antibody has been extensively studied and shown to have various characteristics and functions. It plays a crucial role in immune responses by binding to the CD4 receptor and modulating T cell activation.</p>

<p>GPCR5A antibody was raised using the C terminal Of Gpcr5A corresponding to a region with amino acids SQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDY</p>

<p>Purified recombinant RAP2B protein (His tag)</p>

<p>Purified recombinant ICAM2 protein (His tag)</p>

<p>BCAS2 antibody was raised in Rabbit using Human BCAS2 as the immunogen</p>

<p>Rabbit polyclonal RPAP2 antibody</p>

<p>MTMR8 antibody was raised in Rabbit using Human MTMR8 as the immunogen</p>

<p>Mouse monoclonal Episialin antibody</p>

<p>The His Tag antibody is a highly specific monoclonal antibody that is widely used in Life Sciences research. It is commonly used in assays such as electrophoresis and dodecyl sulfate-polyacrylamide gel (SDS-PAGE) to detect the presence of recombinant proteins with a histidine (His) tag. The His Tag antibody binds specifically to the His tag, allowing for easy detection and purification of the target protein.</p>

<p>The Histone H4 antibody is a highly specialized antibody used in the field of Life Sciences. It is a polyclonal antibody that specifically targets and binds to histone H4, a protein involved in gene regulation and DNA packaging. This antibody has been extensively tested and validated for its specificity and sensitivity.</p>

<p>Rabbit polyclonal Mst1/2 antibody</p>

<p>The SPK antibody is a highly effective growth factor that targets specific protein kinases in the body. It has been extensively studied and proven to neutralize virus surface antigens, making it a valuable tool in viral research and treatment. The SPK antibody is available in both monoclonal and polyclonal forms, allowing for a wide range of applications. Its ability to interfere with the interferon pathway has also been demonstrated, further highlighting its potential in immunological studies. With its buffered formulation and high specificity, the SPK antibody ensures accurate and reliable results in various experiments. Whether you're working in Life Sciences or conducting antigen-antibody reactions, this antibody is an indispensable asset for your research endeavors.</p>

<p>Rabbit polyclonal SH2D1A antibody</p>

<p>Rabbit polyclonal EIF3K antibody</p>

<p>FMNL1 antibody was raised in mouse using recombinant Human Formin-Like 1</p>

<p>TFG antibody is a monoclonal antibody that specifically targets amyloid plaque, a hallmark of various neurodegenerative diseases. This antibody recognizes and binds to the TFG glycoprotein, which is present in amyloid plaques. By binding to these plaques, the TFG antibody helps to clear them from the brain and reduce their accumulation.</p>

<p>Mouse monoclonal WWTR1 antibody</p>

<p>Rabbit polyclonal EPHA2/3/4 antibody (Tyr588/596)</p>

<p>CD29 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>PILRB antibody was raised using the middle region of PILRB corresponding to a region with amino acids KLTITQAVTTTTTWRPSSTTTIAGLRVTESKGHSESWHLSLDTAIRVALA</p>

<p>Rabbit polyclonal COX11 antibody</p>

<p>Ubiquilin 4 antibody was raised using the middle region of UBQLN4 corresponding to a region with amino acids TDIQEPMFSAAREQFGNNPFSSLAGNSDSSSSQPLRTENREPLPNPWSPS</p>

<p>Claudin 18 antibody was raised using the middle region of CLDN18 corresponding to a region with amino acids LVTNFWMSTANMYTGMGGMVQTVQTRYTFGAALFVGWVAGGLTLIGGVMM</p>

<p>SIGLEC9 antibody was raised using the C terminal of SIGLEC9 corresponding to a region with amino acids PWVHLRDAAEFTCRAQNPLGSQQVYLNVSLQSKATSGVTQGVVGGAGATA</p>

<p>Purified Polyclonal CK2 beta antibody</p>

<p>Rabbit anti-mouse IgG2a (Rhodamine) was raised in rabbit using murine IgG2a heavy chain as the immunogen.</p>

<p>Warfarin Conjugate for use in immunoassays</p>

<p>Purified Rabbit polyclonal BORG4 antibody</p>

<p>The RGS2 antibody is a powerful tool in the field of Life Sciences. This antibody is designed to target and inhibit the activity of RGS2, a protein involved in various cellular processes. By binding to RGS2, this antibody effectively blocks its function, leading to a cascade of downstream effects.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NOC3L antibody, catalog no. 70R-3436</p>

<p>MYL4 antibody was raised in Rabbit using Human MYL4 as the immunogen</p>

<p>DRG1 antibody was raised using the middle region of DRG1 corresponding to a region with amino acids VLKPLGHKKIIENELEGFGIRLNSKPPNIGFKKKDKGGINLTATCPQSEL</p>

<p>Rabbit polyclonal RANGRF antibody</p>

<p>Purified recombinant WWC1 protein (His tag)</p>

<p>The EDG1 antibody is a highly specialized monoclonal antibody that plays a crucial role in various biological processes. It has been extensively studied for its ability to target and inhibit the activity of EDG1, a receptor involved in angiogenesis and vascular development. By binding to EDG1, this antibody effectively reduces microvessel density and protease activity, thereby inhibiting the growth factor-mediated formation of new blood vessels.</p>

<p>WARS antibody was raised using the N terminal of WARS corresponding to a region with amino acids EIDSAVKMLVSLKMSYKAAAGEDYKADCPPGNPAPTSNHGPDATEAEEDF</p>

<p>Synaptopodin antibody was raised in mouse using rat kidney glomeruli as the immunogen.</p>

<p>Plakophilin 2 Monoclonal Antibody BSA/Azide Free</p>

<p>Mouse monoclonal KATNB1 antibody</p>

<p>POLK antibody was raised using a synthetic peptide corresponding to a region with amino acids KINKIIMEATKGSRFYGNELKKEKQVNQRIENMMQQKAQITSQQLRKAQL</p>

<p>Rabbit polyclonal TAF12 antibody</p>

<p>Rabbit polyclonal THOC1 antibody</p>

<p>The CDK2 antibody is a highly specialized product used in the field of Life Sciences. It is a polyclonal antibody that specifically targets cyclin-dependent kinase 2 (CDK2), an important protein involved in cell cycle regulation. This antibody is commonly used for various applications such as immunoprecipitation, Western blotting, and immunofluorescence.</p>

<p>KLK-L4 antibody was raised in rabbit using residues 262-277 [IRKYETQQQKWLKGPQ] of the human KLK-L4 protein as the immunogen.</p>

<p>Goat anti-Bovine IgG (H + L) (HRP) was raised in goat using purified Bovine IgG (H&amp;L) as the immunogen.</p>

<p>RELB antibody was raised in rabbit using the middle region of RELB as the immunogen</p>

<p>The CSFR antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the colony-stimulating factor receptor (CSFR), which plays a crucial role in cell growth and differentiation. This antibody can be used for various applications, including immunohistochemistry, flow cytometry, and Western blotting.</p>

<p>FICD antibody was raised using the C terminal of FICD corresponding to a region with amino acids GDVRPFIRFIAKCTETTLDTLLFATTEYSVALPEAQPNHSGFKETLPVKP</p>

<p>KIR2DL3 antibody was raised in Rabbit using Human KIR2DL3 as the immunogen</p>

<p>HIBADH antibody was raised using the middle region of HIBADH corresponding to a region with amino acids WSSDTYNPVPGVMDGVPSANNYQGGFGTTLMAKDLGLAQDSATSTKSPIL</p>

<p>Rabbit polyclonal RNF149 antibody</p>

<p>The Myc Tag antibody is a highly effective and neutralizing antibody that is widely used in the field of Life Sciences. This antibody specifically targets the Myc epitope, which is a short amino acid sequence commonly fused to proteins for detection and purification purposes. The Myc Tag antibody has been extensively validated and proven to recognize the Myc tag with high specificity and sensitivity.</p>

<p>Estradiol 17b antibody was raised in mouse using 17-beta estradiol-BSA conjugate as the immunogen.</p>

<p>Rabbit polyclonal CEP97 antibody</p>

<p>Goat anti-mouse IgG (Fab'2) (Rhodamine) was raised in goat using murine IgG F(ab')2 fragment as the immunogen.</p>

<p>Mouse monoclonal CRYM antibody</p>

<p>Rabbit Polyclonal OR4F6 antibody</p>

<p>WBP11 antibody was raised using the N terminal of WBP11 corresponding to a region with amino acids GRRSTSSTKSGKFMNPTDQARKEARKRELKKNKKQRMMVRAAVLKMKDPK</p>

<p>Purified Polyclonal MKK2 antibody</p>

<p>Ceftazidime, d 3 isomers (USP grade powder) chemical reference substance</p>

<p>Purified recombinant PAICS protein (His tag)</p>

<p>Mouse monoclonal FCGR2A antibody</p>

<p>Armenian Hamster monoclonal PD1 antibody (FITC)</p>

<p>HN1 antibody was raised in Rabbit using Human HN1 as the immunogen</p>

<p>The Glucagon antibody is a monoclonal antibody that targets pancreatic glucagon, a hormone that plays a crucial role in regulating blood sugar levels. This antibody has been extensively studied in the field of neurotrophic factors and growth factors. It has shown promising results in promoting neuroprotective effects and stimulating the production of new neurons.</p>

<p>Mouse monoclonal NT5DC1 antibody</p>

<p>Rabbit polyclonal FGF16 antibody</p>

<p>PABPC5 antibody was raised using a synthetic peptide corresponding to a region with amino acids DAEWALNTMNFDLINGKPFRLMWSQPDDRLRKSGVGNIFIKNLDKSIDNR</p>

<p>Purified Polyclonal 5HT1D antibody</p>

<p>24-99 amino acids: MGSSHHHHHH SSGLVPRGSH MQPDAINAPV TCCYNFTNRK ISVQRLASYR RITSSKCPKE AVIFKTIVAK EICADPKQKW VQDSMDHLDK QTQTPKT</p>

<p>Rabbit polyclonal ERD23 antibody</p>

<p>Beta galactosidase antibody was raised in rabbit using full length native beta galactosidase isolated from E.coli as the immunogen.</p>

<p>HAT1 antibody was raised in Rabbit using Human HAT1 as the immunogen</p>

<p>Rabbit polyclonal ABCA8 antibody</p>

<p>Purified Polyclonal CKMT2 antibody</p>

<p>The UCHL1 antibody is a highly specialized monoclonal antibody that exhibits cytotoxic properties. It targets the UCHL1 protein, which plays a crucial role in various biological processes such as tyrosinase regulation, insulin secretion, and calpastatin activity. This antibody specifically binds to the UCHL1 protein and inhibits its function, making it an essential tool for researchers in the Life Sciences field.</p>

<p>HRP conjugated Rabbit polyclonal Ovalbumin antibody</p>

<p>DPP10 antibody was raised using the middle region of DPP10 corresponding to a region with amino acids VNYTMQVYPDEGHNVSEKSKYHLYSTILKFFSDCLKEEISVLPQEPEEDE</p>

<p>Mouse monoclonal GTF2F1 antibody</p>

<p>Purified Rabbit polyclonal PR antibody (Ser294)</p>

<p>The Growth hormone receptor protein is a crucial component in Life Sciences. It acts as an inhibitory factor against glial fibrillary acidic emission and interleukin-6 factor-α. This protein plays a significant role in regulating the growth hormone receptor, which is essential for various biological processes. The acidic nature of the protein allows it to bind effectively to cellulose, activating its neutralizing and reactive properties. Conjugated Proteins, such as interferon, are also influenced by this protein, making it a vital player in the field of Proteins and Antigens.</p>

<p>The MN1 antibody is a powerful tool in Life Sciences research. It is a polyclonal antibody that specifically targets fibrinogen, an activated protein involved in blood clotting. This antibody can be used in various applications, including immunohistochemistry, Western blotting, and ELISA assays. The MN1 antibody has been shown to effectively bind to virus surface antigens and neutralize their activity, making it a valuable tool for antiviral research. Additionally, this antibody has been used in mass spectrometric methods to identify and quantify chemokines and interferons in human serum samples. With its high specificity and affinity, the MN1 antibody is an essential component of any researcher's toolkit in the field of Life Sciences.</p>

<p>Mouse monoclonal PECR antibody</p>

<p>The Caspase 6 antibody is a highly specialized immunoassay tool designed for neutralizing the activity of Caspase 6, a drug antibody that plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be effective in inhibiting the growth factor signaling pathway mediated by Caspase 6. Additionally, it has shown promising results as a potential therapeutic agent for diseases involving abnormal cell proliferation.</p>

<p>Rabbit polyclonal MED13L antibody</p>

<p>SPHK1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>RAD18 antibody was raised using a synthetic peptide corresponding to a region with amino acids KQVTKVDCPVCGVNIPESHINKHLDSCLSREEKKESLRSSVHKRKPLPKT</p>

<p>Monoclonal Rat anti-Mouse IgD antibody (FITC)</p>

<p>Purified Polyclonal Monoamine Oxidase A antibody</p>

<p>Recombinant Human GBA3 protein</p>

<p>Mouse monoclonal NK1.1 antibody (FITC)</p>

<p>Please enquire for more information about 4-Methoxy(toluene-d7) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>TAF15 antibody was raised using a synthetic peptide corresponding to a region with amino acids PDYGQQDSYDQQSGYDQHQGSYDEQSNYDQQHDSYSQNQQSYHSQRENYS</p>

<p>PAPK antibody was raised in rabbit using residues 399-418 (SPWSELEFQFPDDKDPVWEF) of the mouse PAPK protein as the immunogen.</p>

<p>TCTE1 antibody was raised using the middle region of TCTE1 corresponding to a region with amino acids MNFEWNLFLFTYRDCLSLAAAIKACHTLKIFKLTRSKVDDDKARIIIRSL</p>

<p>Mouse monoclonal NUPR1 antibody</p>

<p>Mouse monoclonal H6PD antibody</p>