Bioquímicos e reagentes

<p>Rabbit polyclonal SERF2 antibody</p>

<p>The ABL1 antibody is a highly specialized product in the field of Life Sciences. It belongs to the class of Polyclonal Antibodies and is specifically designed to target adipose lipase. This monoclonal antibody plays a crucial role in regulating triglyceride lipase activity, which is essential for maintaining lipid homeostasis. Additionally, it has been shown to interact with various growth factors, including endothelial growth factor and hepatocyte growth factor receptor.</p>

<p>Mouse monoclonal MRRF antibody</p>

<p>Purified recombinant Human EMCN protein (His tag)</p>

<p>GMF gamma antibody was raised using the middle region of GMFG corresponding to a region with amino acids KVDKDRQMVVLEEEFQNISPEELKMELPERQPRFVVYSYKYVHDDGRVSY</p>

<p>Rabbit polyclonal SPANXC antibody</p>

<p>KIF15 antibody was raised using the middle region of KIF15 corresponding to a region with amino acids SKKHSGLLQSAQEELTKKEALIQELQHKLNQKKEEVEQKKNEYNFKMRQL</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PDIK1L antibody, catalog no. 70R-4178</p>

<p>Rabbit polyclonal SLITRK3 antibody</p>

<p>Recombinant Human QTRT1 protein with His tag</p>

<p>Rabbit polyclonal B3GALT2 antibody</p>

<p>MYBPC2 antibody was raised using the N terminal of MYBPC2 corresponding to a region with amino acids KEAPPEDQSPTAEEPTGVFLKKPDSVSVETGKDAVVVAKVNGKELPDKPT</p>

<p>Rat monoclonal CD115 antibody (allophycocyanin)</p>

<p>The L1CAM antibody is a monoclonal antibody that is widely used in the field of Life Sciences. It specifically targets L1 cell adhesion molecule (L1CAM), which plays a crucial role in cell-to-cell interactions and neural development. This antibody has been extensively studied and validated for various applications, including immunohistochemistry and Western blotting.</p>

<p>Rabbit polyclonal GPR139 antibody</p>

<p>The RAB39A antibody is a highly effective tool used in various research and diagnostic applications. This antibody specifically targets β-catenin, an important protein involved in cell adhesion and signaling pathways. It is available as both monoclonal and polyclonal antibodies, providing researchers with options to suit their specific needs.</p>

<p>Rabbit polyclonal LAMB3 antibody</p>

<p>TIGD1 antibody was raised using the middle region of TIGD1 corresponding to a region with amino acids SQLMRKASPMSYFRKLPQPPQPSAATTLTSQQPSTSRQDPPPAKRVRLTE</p>

<p>The NGAL antibody is a glycoprotein that specifically targets a polypeptide found in mesenchymal stem cells. It is a Monoclonal Antibody that has been developed using adeno-associated virus (AAV) technology. This antibody has neutralizing properties, meaning it can block the activity of the target polypeptide and prevent its function. The NGAL antibody can be used for various applications, including research in the field of Life Sciences, as well as for therapeutic purposes. It is produced through a hybridoma cell line and can be conjugated with maleimide or other molecules to enhance its specificity or functionality. Additionally, this antibody has shown antiviral properties and may have potential applications in the treatment of viral infections.</p>

<p>Rabbit polyclonal SPINT1 antibody</p>

<p>The SCF antibody is a monoclonal antibody that specifically targets the stem cell factor (SCF). It is widely used in life sciences research, particularly in the field of adipocyte biology. SCF plays a crucial role in the development and function of adipose tissue, making it an important target for therapeutic interventions related to obesity and metabolic disorders.</p>

<p>Mouse monoclonal CYB5R1 antibody</p>

<p>CSHL1 antibody was raised using the C terminal of CSHL1 corresponding to a region with amino acids GQTLKQTYSKFDTNSHNHDALLKNYGLLHCFRKDMDKVETFLRMVQCRSV</p>

<p>The RNF20 antibody is a highly specialized antibody used in Life Sciences research. It is available in both polyclonal and monoclonal forms. This antibody specifically targets mucin, a glycoconjugate that plays a crucial role in cell growth and development. The RNF20 antibody can be used for various applications, including lysis of cells, neutralizing specific proteins or growth factors, and detecting the presence of mucin in samples. It is a valuable tool for researchers studying cellular processes and exploring potential therapeutic targets. Whether you need a polyclonal or monoclonal antibody, the RNF20 antibody offers high specificity and potency to support your scientific investigations.</p>

<p>The Rat IgM antibody is a highly versatile and effective tool used in various research applications in the field of Life Sciences. This antibody belongs to the category of Isotype Controls and is widely used as a control for experiments involving monoclonal antibodies. It specifically targets molecules such as trastuzumab, tyrosine, cortisol, and low-density lipoprotein (LDL).</p>

<p>Prolactin antibody was raised in mouse using human prolactin as the immunogen.</p>

<p>Mouse monoclonal AKR7A3 antibody</p>

<p>LTA4H antibody was raised in Rabbit using Human LTA4H as the immunogen</p>

<p>Purified Rabbit polyclonal CDYL2 antibody</p>

<p>Rabbit polyclonal MIF antibody (HRP)</p>

<p>The NMT2 antibody is a highly specific monoclonal antibody that is derived from a hybridoma cell line. It targets the chemokine NMT2, a glycoprotein that is activated in certain disease conditions. This antibody has been extensively studied and has shown great potential as a therapeutic agent in various medical applications.</p>

<p>Rabbit polyclonal SPAG6 antibody</p>

<p>Mouse monoclonal EPM2AIP1 antibody</p>

<p>Purified recombinant ZNRD1 protein (His tag)</p>

<p>The AQP1 antibody is a highly activated steroid monoclonal antibody that is commonly used in the field of Life Sciences. It specifically targets the AQP1 protein, which plays a crucial role in regulating water transport across cell membranes. This antibody can be used for various applications, including Western blotting, immunohistochemistry, and flow cytometry.</p>

<p>The UCHL1 protein is a multifunctional protein that plays a crucial role in various biological processes. It has been extensively studied in the field of Life Sciences and has shown promising applications in different areas.</p>

<p>COX10 antibody was raised using the middle region of COX10 corresponding to a region with amino acids APGPFDWPCFLLTSVGTGLASCAANSINQFFEVPFDSNMNRTKNRPLVRG</p>

<p>Purified recombinant MUP1 protein (His tag)</p>

<p>Purified Recombinant Dengue 2 protein</p>

<p>FOLH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVA</p>

<p>TBK1 antibody was raised using the middle region of TBK1 corresponding to a region with amino acids QEGTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLAYNEEQIHKFDKQ</p>

<p>Purified recombinant CSDC2 protein (His tag)</p>

<p>Purified recombinant SURF2 protein (His tag)</p>

<p>Purified Polyclonal EEF2K antibody</p>

<p>AHR antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>KCNA5 antibody was raised in rabbit using the N terminal of KCNA5 as the immunogen</p>

<p>Rat monoclonal CD45R antibody (PE)</p>

<p>Purified Polyclonal ZADH2 antibody</p>

<p>The SOCS3 antibody is a highly effective monoclonal antibody that is widely used in the field of Life Sciences. It is colloidal in nature and specifically targets autoantibodies. The antibody works by inhibiting the glycosylation process and blocking the activity of the phosphatase enzyme. Additionally, it has been shown to effectively neutralize the action of various growth factors.</p>

<p>Rabbit polyclonal STK16 antibody</p>

<p>Purified Polyclonal CIB4 antibody</p>

<p>Rabbit polyclonal MAD1 antibody (Ser428)</p>

<p>TAPBP antibody was raised using a synthetic peptide corresponding to a region with amino acids GKGLAKRPGALLLRQGPGEPPPRPDLDPELYLSVHDPAGALQAAFRRYPR</p>

<p>Rabbit polyclonal RASSF8 antibody</p>

<p>Rabbit polyclonal TGS1 antibody</p>

<p>CDH16 antibody was raised using the N terminal of CDH16 corresponding to a region with amino acids SDRDEPGTANSDLRFHILSQAPAQPSPDMFQLEPRLGALALSPKGSTSLD</p>

<p>CARD8 antibody was raised in mouse using recombinant Human Caspase Recruitment Domain Family, Member 8 (Card8)</p>

<p>RANKL antibody was raised in rabbit using highly pure recombinant murine sRANKL as the immunogen.</p>

<p>MAGEA9 antibody was raised in rabbit using the middle region of MAGEA9 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PSEN1 antibody, catalog no. 70R-6264</p>

<p>MPZL2 antibody was raised in Rabbit using Human MPZL2 as the immunogen</p>

<p>Nephronectin antibody was raised using the middle region of NPNT corresponding to a region with amino acids TTGLTTIAPAASTPPGGITVDNRVQTDPQKPRGDVFIPRQPSNDLFEIFE</p>

<p>Rabbit polyclonal CDKAL antibody</p>

<p>The Presenilin 1 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets and binds to Presenilin 1, a protein involved in the processing of fatty acids and acidic compounds. This antibody has been extensively studied for its role in various cellular processes, including the regulation of interleukin-6, epidermal growth factor, annexin proteins, erythropoietin, and natriuretic factors. Researchers use this antibody to investigate the function and interactions of Presenilin 1 in different biological systems. Additionally, polyclonal antibodies are also available for wider applications. These antibodies are valuable tools for scientists studying growth factors, signaling pathways, and disease mechanisms. With their high specificity and sensitivity, both monoclonal and polyclonal Presenilin 1 antibodies provide reliable results for researchers in need of accurate protein detection and analysis.</p>

<p>Purified Rabbit polyclonal Smad3 antibody (Ser208)</p>

<p>Syrian Hamster monoclonal IgG Isotype Control antibody (PE)</p>

<p>CCDC22 antibody was raised in Rabbit using Human CCDC22 as the immunogen</p>

<p>Recombinant Human HYKK protein</p>

<p>VNN3 antibody was raised using the N terminal of VNN3 corresponding to a region with amino acids VILPNRTETPVSKEEALLLMNKNIDVLEKAVKLAAKQGAHIIVTPEDGIY</p>

<p>Purified recombinant MBP protein (His tag)</p>

<p>Rat monoclonal CD25 antibody (biotin)</p>

<p>The POR antibody is a highly specialized antibody that targets the messenger RNA (mRNA) of the primary amino acid sequence of the POR protein. This antibody is designed to specifically bind to the POR protein and can be used in various research applications, such as Western blotting, immunohistochemistry, or flow cytometry.</p>

<p>The ERK2 antibody is a highly specific monoclonal antibody that targets the extracellular signal-regulated kinase 2 (ERK2). This antibody plays a crucial role in various cellular processes, including cell growth, proliferation, and differentiation. It is commonly used in research and diagnostic applications to study the activation of ERK signaling pathways.</p>

<p>Erythropoietin protein is a long-acting preparation of endogenous erythropoietin, a hormone that stimulates the production of red blood cells. This protein has been shown to have various effects on different cell types. It regulates the synthesis and secretion of TGF-beta in human hepatocytes, which plays a crucial role in tissue repair and fibrosis. Erythropoietin protein can also modulate chemokine expression and enhance the migration of immune cells to sites of inflammation. Additionally, it has been used as a conjugated protein with monoclonal antibodies for targeted drug delivery. Erythropoietin protein is commonly used in the field of life sciences for research purposes and as an ingredient in pharmaceutical formulations. It can be combined with other drugs such as ketorolac, gabapentin, or imatinib to enhance their therapeutic effects. The formulation may contain excipients like collagen to improve stability and bioavailability. With its diverse applications and potent biological activity</p>

<p>The L1CAM antibody is a highly activated monoclonal antibody that targets CD33, a protein found on the surface of adipose cells. This antibody is reactive and has been extensively studied in the field of Life Sciences. It has been shown to have neutralizing properties, inhibiting the growth factor signaling pathways associated with adipose tissue development. Additionally, this antibody has hepatoprotective effects, protecting liver cells from damage caused by lipofuscin accumulation. The L1CAM antibody can also activate phosphatase and 3-kinase enzymes, which play crucial roles in cellular signaling pathways. With its high specificity and potency, this monoclonal antibody is an excellent tool for research and therapeutic applications in various fields.</p>

<p>ROM1 antibody was raised using the middle region of ROM1 corresponding to a region with amino acids NPHSPRPCLQNRLSDSYAHPLFDPRQPNQNLWAQGCHEVLLEHLQDLAGT</p>

<p>KCNJ12 antibody was raised using the middle region of KCNJ12 corresponding to a region with amino acids KDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQAR</p>

<p>RGS19 antibody was raised using the N terminal of RGS19 corresponding to a region with amino acids PTPHEAEKQITGPEEADRPPSMSSHDTASPAAPSRNPCCLCWCCCCSCSW</p>

<p>Purified recombinant NPPC protein (His tag)</p>

<p>Purified Polyclonal Plexin A2 antibody</p>

<p>Mouse monoclonal ALDH3A2 antibody</p>

<p>Purified Rabbit polyclonal IKK gamma antibody</p>

<p>Mouse monoclonal LIPG antibody</p>

<p>The CEA antibody is a monoclonal antibody that acts as a family kinase inhibitor. It is used in the field of Life Sciences as an anticoagulant and inhibitory factor. This monoclonal antibody targets autoantibodies and antibodies, specifically dopamine antigen tyrosine. It has been extensively studied and tested using electrodes and interferon in human serum. With its unique properties, the CEA antibody offers promising potential for various applications in research and clinical settings.</p>

<p>SEC63 antibody was raised using a synthetic peptide corresponding to a region with amino acids WPRDQNAEQIRLKNIRKVYGRCMWYRLRLLKPQPNIIPTVKKIVLLAGWA</p>

<p>The CRYAB antibody is a highly effective medicine that has been developed to target specific diseases and conditions. This antibody works by inhibiting the activity of certain enzymes and proteins that are involved in the development and progression of these conditions. It has been shown to be particularly effective against vaccine strains of diseases, as well as collagen-related disorders.</p>

<p>Rabbit polyclonal Osteopontin antibody (biotin)</p>

<p>TST antibody was raised using a synthetic peptide corresponding to a region with amino acids GEHLGSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHPVTSEPSRPEP</p>

<p>The Synaptotagmin antibody is a highly effective medicament that belongs to the class of monoclonal antibodies. It is specifically designed to target and bind to synaptotagmin, a protein involved in neurotransmitter release at synapses. This antibody works by blocking the binding of synaptotagmin to its receptor proteins, thereby inhibiting synaptic transmission and reducing neuronal activity.</p>

<p>Rabbit polyclonal RCBTB2 antibody</p>

<p>Rabbit polyclonal NA14 antibody</p>

<p>LAD1 antibody was raised in Rabbit using Human LAD1 as the immunogen</p>

<p>Purified Rabbit polyclonal OR2D3 antibody</p>

<p>SIGLEC7 antibody was raised using the middle region of SIGLEC7 corresponding to a region with amino acids WTWRSLTLYPSQPSNPLVLELQVHLGDEGEFTCRAQNSLGSQHVSLNLSL</p>

<p>The CYP2A6 antibody is a polyclonal antibody that specifically targets the CYP2A6 protein. This protein is a member of the cytochrome P450 family and plays a crucial role in drug metabolism. The CYP2A6 antibody can be used for various applications, including research on growth factors, antibodies, and cytotoxicity. It has been widely used in studies involving serum albumin protein, monoclonal antibodies, cytotoxic conjugates, basic proteins, and human serum. Additionally, this antibody has shown inhibitory effects on EGF-like glycosylation and can be used in the development of anti-CD20 antibodies and autoantibodies. Its high specificity and affinity make it an excellent tool for studying the function and regulation of the CYP2A6 protein.</p>

<p>E2F2 antibody was raised in mouse using recombinant Human E2F Transcription Factor 2 (E2F2)</p>

<p>Mouse monoclonal PLEK antibody</p>

<p>The CD3E antibody is a highly specialized monoclonal antibody that is widely used in the field of Life Sciences. It specifically targets and neutralizes alpha-fetoprotein, a protein complex found in human serum. The CD3E antibody has been extensively studied for its binding properties to steroid binding proteins, particularly those involved in nuclear receptor signaling pathways. This antibody is known for its high affinity and specificity, making it an ideal tool for research and diagnostic applications. Whether you are studying protein-protein interactions or investigating the role of specific molecules in cellular processes, the CD3E antibody is an essential tool in your arsenal. Trust this monoclonal antibody to deliver accurate and reliable results for all your scientific endeavors.</p>

<p>Rbm3 antibody was raised in rabbit using the N terminal of Rbm3 as the immunogen</p>

<p>The Chlorpromazine antibody is a highly specialized monoclonal antibody that specifically targets and binds to chlorpromazine, a metal-binding protein. This multispecific antibody is designed to recognize and bind to specific lysine and acid residues on chlorpromazine molecules. The Chlorpromazine antibody can be used in various applications, such as immunohistochemistry, flow cytometry, and Western blotting.</p>