Bioquímicos e reagentes

<p>The ALDH1L1 antibody is a neutralizing protein that plays a crucial role in the growth factor signaling pathway. It is commonly used in Life Sciences research to study the functions of various growth factors. This monoclonal antibody specifically targets ALDH1L1, which is an acidic protein involved in hepatocyte growth and androgen regulation. The ALDH1L1 antibody can effectively bind to ALDH1L1 and inhibit its activity, thereby modulating cellular processes such as fibronectin production and protein complex formation. Additionally, this antibody has been shown to interact with cytochrome proteins, insulin receptors, and low-density lipoproteins. With its high specificity and potency, the ALDH1L1 antibody is an essential tool for researchers studying growth factor signaling pathways and related biological processes.</p>

<p>Rabbit polyclonal VPREB3 antibody</p>

<p>Rabbit polyclonal Alpha synuclein antibody (FITC)</p>

<p>Rabbit polyclonal ACC1 antibody (Ser80)</p>

<p>Mouse monoclonal CRYM antibody</p>

<p>The BTK antibody is a monoclonal antibody used in the field of Life Sciences. It specifically targets and inhibits Bruton's tyrosine kinase (BTK), an enzyme involved in various cellular processes. This antibody has been extensively studied and proven to be effective in blocking BTK activity, making it a valuable tool for researchers studying signal transduction pathways and immune system function.</p>

<p>The TGFBR3 antibody is a biomolecule that belongs to the class of antibodies. It acts as an inhibitor of natriuretic peptides and plays a crucial role in regulating the functions of mesenchymal stem cells. In the field of Life Sciences, this cytotoxic antibody is widely used for various applications, including nuclear staining and immunohistochemistry. Both monoclonal and polyclonal antibodies are available for targeting TGFBR3. By blocking the interaction between TGFBR3 and its ligands, such as brain natriuretic peptide, this antibody inhibits the activation of downstream signaling pathways involved in cell growth and differentiation. The reaction solution containing this antibody can be used to study the acetylation status of TGFBR3 and its impact on cellular processes.</p>

<p>Rabbit polyclonal FTH1 antibody (FITC)</p>

<p>Rabbit polyclonal SUCLA2 antibody</p>

<p>CD3 antibody (Spectral Red) was raised in mouse using the epsilon chain of CD3/T-cell antigen receptor complex as the immunogen.</p>

<p>SULT2B1 antibody was raised using the middle region of SULT2B1 corresponding to a region with amino acids YSKIAGQLKDPGTPDQFLRDFLKGEVQFGSWFDHIKGWLRMKGKDNFLFI</p>

<p>Chymotrypsin antibody was raised in rabbit using human pancreatic chymotrypsin as the immunogen.</p>

<p>Purified recombinant NAP1L4 protein (His tag)</p>

<p>Rabbit polyclonal SNRPD2 antibody</p>

<p>Rat monoclonal CD45 antibody (FITC)</p>

<p>Septin 10 antibody was raised using the C terminal of 40431 corresponding to a region with amino acids ERMKLEEKRRLLEEEIIAFSKKKATSEIFHSQSFLATGSNLRKDKDRKNS</p>

<p>ETV3 antibody was raised in mouse using recombinant Ets Variant Gene 3</p>

<p>Nanog antibody was raised using the N terminal of NANOG corresponding to a region with amino acids ESSLTPVTCGPEENYPSLQMSSAEMPHAETVSPLPSSMDLLIQDSPDSST</p>

<p>ACD antibody was raised using a synthetic peptide corresponding to a region with amino acids KNRPPFPRTGATRGAQEPCSVWEPPKRHRDGSAFQYEYEPPCTSLCARVQ</p>

<p>TNFSF13B antibody was raised using a synthetic peptide corresponding to a region with amino acids ALQGDLASLRAELQGHHAEKLPAGAGAPKAGLEEAPAVTAGLKIFEPPAP</p>

<p>Rabbit polyclonal SCML1 antibody</p>

<p>SOHLH2 antibody was raised in rabbit using the middle region of SOHLH2 as the immunogen</p>

<p>PEX5 antibody was raised using the middle region of PEX5 corresponding to a region with amino acids LNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLL</p>

<p>KLHL13 antibody was raised in rabbit using the N terminal of KLHL13 as the immunogen</p>

<p>Desmoplakin 1+2 antibody was raised in mouse using synthetic peptide of human desmoplakin 2 as the immunogen.</p>

<p>ZNF598 antibody was raised in rabbit using the middle region of ZNF598 as the immunogen</p>

<p>The PNMA5 antibody is an activated agent that targets autoantibodies against the PNMA5 protein. This protein is involved in various biological processes, including methylation and regulation of gene expression. The PNMA5 antibody can be used as a diagnostic tool to detect the presence of these autoantibodies in patient serum, making it a valuable serum marker for certain diseases. Additionally, this antibody can be used in research settings to study the function and role of PNMA5 in different cell types, including pluripotent stem cells. Its ability to bind specifically to the glycoprotein allows for accurate detection and analysis of PNMA5 levels. With its wide range of applications in Life Sciences, this antibody is a powerful tool for scientists studying interferon-stimulated genes, interleukins, dopamine receptors, acetylcholine receptors, and transmembrane conductance.</p>

<p>Purified recombinant BEST1 protein (His tag)</p>

<p>The MCM8 antibody is a highly specialized monoclonal antibody that targets the MCM8 protein, which plays a crucial role in DNA replication and cell cycle regulation. This antibody is derived from human serum and has been extensively tested for its efficacy and specificity.</p>

<p>The SNX17 antibody is a monoclonal antibody that specifically targets the interferon-activated autoantibodies present in adipose tissue. This antibody has cytotoxic properties and can neutralize the effects of these autoantibodies, making it a valuable tool in Life Sciences research. SNX17 antibody is also capable of binding to galectin-3, a biomolecule involved in various cellular processes. By targeting galectin-3, this antibody can potentially modulate its function and provide insights into its role in disease progression. Whether you need a reliable tool for immunohistochemistry or Western blotting, the SNX17 antibody offers high specificity and sensitivity for your research needs. Additionally, it is available as both monoclonal and polyclonal antibodies, providing flexibility for different experimental setups. Trust the SNX17 antibody to deliver accurate and reproducible results in your studies.</p>

<p>MLLT3 antibody was raised in rabbit using the N terminal of MLLT3 as the immunogen</p>

<p>KDS2010 is a neuroprotective drug that has been shown to reduce the progression of Parkinson's disease and Alzheimer's disease in clinical trials. It is a potent GABA receptor agonist that produces a rapid, reversible increase in intracellular levels of gamma-aminobutyric acid (GABA) by binding to the GABA receptor and inhibiting its ion channel activity. KDS2010 also stimulates the release of dopamine, which may be responsible for its therapeutic effects. KDS2010 is an attenuating agent that reduces neuronal death by attenuating reactive oxygen species generation and preventing the depletion of glutathione.</p>

<p>Streptavidin antibody was raised in mouse using the streptavidin molecule of Streptomyces avidinii as the immunogen.</p>

<p>The CCR3 antibody is a monoclonal antibody that specifically targets the CCR3 molecule. It has been extensively studied in the field of Life Sciences and has shown promising results in various applications. The CCR3 antibody has been used to detect activated cholinergic neurons in the brain and has been found to play a crucial role in the regulation of β-catenin and caspase-9 signaling pathways. This antibody can be used in research studies to investigate the expression and function of CCR3 in different cell types and tissues. Additionally, it has been used as a diagnostic tool for detecting specific proteins, such as alpha-fetoprotein, in human serum samples. The CCR3 antibody is highly specific and exhibits excellent binding affinity, making it an ideal choice for researchers working on projects related to immunology, neuroscience, and molecular biology.</p>

<p>Fmo3 antibody was raised in rabbit using the middle region of Fmo3 as the immunogen</p>

<p>Mouse Monoclonal GYS1 antibody</p>

<p>PCDHGA4 antibody was raised using the N terminal of PCDHGA4 corresponding to a region with amino acids GDPVRSGTARILIILVDTNDNAPVFTQPEYHVSVRENVPVGTRLLTVKAT</p>

<p>Influenza A antibody was raised in mouse using Influenza A as the immunogen.</p>

<p>Mouse monoclonal HDHD1 antibody</p>

<p>FSTL5 antibody was raised using the middle region of FSTL5 corresponding to a region with amino acids NRQIQDSGLFGQYLMTPSKDSLFILDGRLNKLNCEITEVEKGNTVIWVGD</p>

<p>LOC115648 antibody was raised in rabbit using the middle region of LOC115648 as the immunogen</p>

<p>The ActA antibody is a highly specialized monoclonal antibody that acts as an inhibitor of protein kinase activity. It is specifically designed to target and neutralize the activated form of ActA, a protein involved in various cellular processes. This antibody has shown cytotoxic effects against cells expressing high levels of ActA, making it a promising therapeutic option for diseases associated with dysregulated ActA signaling.</p>

<p>Rabbit polyclonal SKP1A antibody</p>

<p>Mouse monoclonal DCXR antibody</p>

<p>Purified Rabbit polyclonal NACAD antibody</p>

<p>Rabbit polyclonal Twist2 antibody</p>

<p>Rabbit polyclonal SMAD3 antibody (Ser425)</p>

<p>Rabbit polyclonal LCN2 antibody (HRP)</p>

<p>KRT33B antibody was raised in Rabbit using Human KRT33B as the immunogen</p>

<p>VPS37A antibody was raised using a synthetic peptide corresponding to a region with amino acids SWLFPLTKSASSSAAGSPGGLTSLQQQKQRLIESLRNSHSSIAEIQKDVE</p>

<p>Akt, also known as Protein Kinase B (PKB), is a critical signaling protein in cells that regulates essential processes like cell growth, survival, metabolism, and proliferation. It functions within the PI3K/Akt pathway, one of the primary pathways for cell survival and growth, which is activated by growth factors and hormones such as insulin. Upon activation, Akt is recruited to the cell membrane, where it is phosphorylated by kinases like PDK1, triggering its full activation. This allows Akt to influence downstream processes, promoting cell survival by inhibiting apoptosis, supporting cell growth via pathways like mTOR, and enhancing glucose metabolism—especially important for insulin response.Akt plays a significant role in diseases like cancer and diabetes. Dysregulation of the Akt pathway is frequently observed in cancer, often due to mutations in pathway components such as PI3K, PTEN, or Akt itself, resulting in increased cell survival, growth, and resistance to therapies. In diabetes, insulin resistance diminishes Akt pathway responsiveness, reducing glucose uptake and leading to elevated blood glucose levels. Thus, the Akt pathway is a focal point in therapeutic research, particularly for diseases where its regulatory effects on cell growth and metabolism are implicated.</p>

<p>ACE antibody was raised in mouse using ACE (denatured) from human kidney as the immunogen.</p>

<p>Pxmp3 antibody was raised in rabbit using the N terminal of Pxmp3 as the immunogen</p>

<p>Mouse monoclonal C21orf59 antibody</p>

<p>The CD28 antibody is a highly specialized monoclonal antibody that is used in the field of Life Sciences. It specifically targets activated CD28, a protein found on the surface of immune cells. This antibody has been extensively studied and has shown promising results in various applications.</p>

<p>The ZAP70 antibody is a powerful staining reagent that is widely used in the field of Life Sciences. It belongs to the class of Polyclonal Antibodies and has been extensively studied for its role in ferroptosis, a form of regulated cell death. This antibody specifically targets ZAP70, a protein involved in signal transduction pathways in immune cells.</p>

<p>GLT8D1 antibody was raised using the middle region of GLT8D1 corresponding to a region with amino acids LLIVFYQQHSTIDPMWNVRHLGSSAGKRYSPQFVKAAKLLHWNGHLKPWG</p>

<p>The TRPM4 antibody is a highly specialized antibody used in the field of life sciences. It is specifically designed to target and neutralize the TRPM4 protein, which plays a crucial role in cellular processes such as calcium signaling and ion transport. This monoclonal antibody has been extensively tested and proven to be highly reactive and effective in inhibiting the activity of TRPM4.</p>

<p>Mouse monoclonal GAS7 antibody</p>

<p>The ST3GAL6 antibody is a powerful tool in the field of Life Sciences. It specifically targets the glycation of carbonic and fibrinogen, making it an ideal neutralizing agent for these molecules. This monoclonal antibody has been extensively tested and proven to effectively bind to virus surface antigens, inhibiting their activation and replication. Additionally, the ST3GAL6 antibody has shown anticoagulant properties, making it a valuable tool in preventing blood clotting disorders. Its specificity and efficacy have been confirmed using mass spectrometric methods, ensuring accurate and reliable results. Whether you are conducting research or developing therapeutics, the ST3GAL6 antibody is an essential component in your toolkit.</p>

<p>Mouse monoclonal FBXO31 antibody</p>

<p>Rabbit polyclonal TFDP1 antibody</p>

<p>The ANXA1 antibody is a highly effective inhibitor used in Life Sciences research. It is a monoclonal antibody that specifically targets and neutralizes the circovirus, preventing its replication and spread. Additionally, this antibody has been shown to inhibit the activity of epidermal growth factor, which is involved in cell proliferation and differentiation. Furthermore, the ANXA1 antibody exhibits cytotoxic properties, causing cell death in certain cancer cells. This protein also plays a role in amyloid plaque formation, making it an important target for Alzheimer's disease research. The ANXA1 antibody can be used to detect and quantify the presence of mycoplasma genitalium, a common sexually transmitted infection. Moreover, autoantibodies against annexin have been found to be associated with autoimmune disorders such as lupus and rheumatoid arthritis. Lastly, this antibody has been shown to prevent hemolysis (the destruction of red blood cells) induced by certain growth factors.</p>

<p>Purified Rabbit polyclonal CDK2 antibody (Thr160)</p>

<p>Purified recombinant EPHX1 protein (T7 tag)</p>

<p>The NGAL antibody is a monoclonal antibody that specifically targets and neutralizes the protein isoforms of neutrophil gelatinase-associated lipocalin (NGAL). NGAL is a biomarker that is present in human serum and has been associated with various diseases and conditions, including kidney injury, inflammation, and cancer. This antibody can be used in Life Sciences research to study the role of NGAL in different physiological and pathological processes.</p>

<p>Mouse monoclonal MTMR14 antibody</p>

<p>PDK4 antibody was raised using the N terminal of PDK4 corresponding to a region with amino acids MKAARFVLRSAGSLNGAGLVPREVEHFSRYSPSPLSMKQLLDFGSENACE</p>

<p>The GAS1 antibody is a highly specialized monoclonal antibody that targets the phosphatase activated cytotoxic protein GAS1. This antibody has been extensively studied and proven to be effective in various research applications. It can be used for immunohistochemistry, western blotting, flow cytometry, and other techniques.</p>

<p>NCT-504 is a peptide that has been shown to activate potassium channels. It binds to the receptor site and activates ion channels, including those for potassium, sodium, and calcium ions. NCT-504 is an inhibitor of ligand-gated ion channels, which are responsible for the transmission of nerve impulses. NCT-504 has been shown to inhibit GABA-A receptor channels in rat brain tissue. This drug also inhibits the binding of antibodies to tumor cells.</p>

<p>STAT6 antibody was raised in rabbit using the C terminal of STAT6 as the immunogen</p>

<p>Rabbit polyclonal RFWD3 antibody</p>

<p>Rat monoclonal CD31 antibody (biotin)</p>

<p>Rabbit polyclonal NOC2 antibody</p>

<p>ATXN7 antibody was raised in rabbit using the middle region of ATXN7 as the immunogen</p>

<p>Binapacryl is a chemical compound classified as an acaricide and fungicide. It is a synthetic product derived from the chemical industry, specifically formulated through complex organic synthesis processes. The mode of action of Binapacryl involves the uncoupling of oxidative phosphorylation in mitochondria, disrupting the energy production within cells, which ultimately leads to the mortality of targeted pests.</p>

<p>The ZIC4 antibody is a highly specialized medicament that targets specific autoantibodies in the body. These autoantibodies are associated with glycosylation and fatty acid modifications, which can lead to various health issues. The ZIC4 antibody works by neutralizing these autoantibodies, thereby reducing their harmful effects on the body.</p>

<p>Mouse monoclonal anti human GSR antibody</p>

<p>The CA 19-9 antibody is a monoclonal antibody that specifically targets the CA 19-9 antigen. This antigen is commonly found in various types of cancer, particularly pancreatic, colorectal, and gastric cancers. The CA 19-9 antibody has been extensively studied and has shown promising results in both diagnostic and therapeutic applications.</p>

<p>LYVE1 antibody was raised in mouse using recombinant human LYVE-1 (25-235 aa) purified from E. coli as the immunogen.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known for its bactericidal activity against tuberculosis infection and is highly effective in inhibiting bacterial growth. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication. The active form of this drug has been extensively studied using advanced techniques like the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains, inhibiting their cell growth in culture.</p>

<p>Mouse monoclonal CHCHD5 antibody</p>

<p>Phencyclidine antibody is a highly specialized antibody used in Life Sciences research. It is designed to specifically target and bind to the phencyclidine molecule, which is a psychoactive drug. This antibody can be used for various assays and experiments to detect the presence of phencyclidine in samples such as human serum or adipose tissue. The use of polyclonal and monoclonal antibodies ensures high specificity and sensitivity in detecting this target molecule. Phencyclidine antibody has also been studied for its potential therapeutic applications, such as in the treatment of thrombocytopenia or as inhibitors of urokinase plasminogen activator. Additionally, it has shown promising results in targeting other molecules like mesothelin or icos antibodies. Its cytotoxic properties make it a valuable tool in research aimed at understanding the effects of phencyclidine and developing treatments for related conditions.</p>

<p>ENTPD7 antibody was raised using the C terminal of ENTPD7 corresponding to a region with amino acids EHRLKYQCFKSAWMYQVLHEGFHFPYDYPNLRTAQLVYDREVQWTLGAIL</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DCBLD1 antibody, catalog no. 70R-6113</p>

<p>ZNF791 antibody was raised in rabbit using the middle region of ZNF791 as the immunogen</p>

<p>The RAGE Blocking Peptide is a highly effective cytotoxic peptide that targets the nuclear receptor RAGE (Receptor for Advanced Glycation Endproducts). It works by blocking the interaction between RAGE and its ligands, which include growth factors and activated antibodies such as anti-HER2 antibody trastuzumab. This blocking action inhibits the downstream signaling pathways associated with RAGE activation, leading to reduced cell proliferation and increased cell death.</p>

<p>FAM54A antibody was raised using the middle region of FAM54A corresponding to a region with amino acids NKTNYSHHSKSQRNKDIPNMLDVLKDMNKVKLRAIERSPGGRPIHKRKRQ</p>

<p>The p300 antibody is a neutralizing agent that acts as an anticoagulant by targeting autoantibodies in human serum. This monoclonal antibody specifically binds to growth factors, such as reactive endothelial growth factor, inhibiting their activity. The p300 antibody can also be conjugated with streptavidin for use in various applications, including the detection of antiphospholipid antibodies and basic proteins. Additionally, polyclonal antibodies and peptide agents can be developed using the p300 antibody for research purposes. With its versatile properties and targeted action, the p300 antibody is a valuable tool in biomedical research and diagnostics.</p>

<p>KIRREL3 antibody was raised in Rabbit using Human KIRREL3 as the immunogen</p>

<p>CD105 antibody was raised in rabbit using recombinant mouse soluble CD105/Endoglin as the immunogen.</p>

<p>The FAM84B antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets FAM84B, a protein involved in various cellular processes. This antibody has been extensively studied and proven to be highly effective in detecting and quantifying FAM84B levels in biological samples.</p>

<p>The MFAP4 antibody is a growth factor that targets epidermal growth factor and belongs to the class of monoclonal antibodies. It has cytotoxic properties and can induce lysis of targeted cells. This antibody specifically binds to the MFAP4 protein, inhibiting its function and preventing collagen synthesis. Additionally, it acts as a neutralizing agent against TGF-beta, a potent cytokine involved in cell proliferation and differentiation. The MFAP4 antibody has been shown to be effective in combination with other therapies such as trastuzumab, an antibody used in the treatment of breast cancer. Furthermore, it has potential applications in the treatment of infections caused by Mycoplasma genitalium, a sexually transmitted bacterium.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the rifamycins class. It is specifically designed to combat tuberculosis infection by targeting active compounds and exhibiting bactericidal activity. The effectiveness of this drug has been demonstrated through transcription-quantitative polymerase chain techniques, as well as patch-clamp techniques on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds to markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>Mouse monoclonal LDLRAP1 antibody</p>

<p>KLRF1 antibody was raised using the middle region of KLRF1 corresponding to a region with amino acids QKGSCSNATQYEDTGDLKVNNGTRRNISNKDLCASRSADQTVLCQSEWLK</p>

<p>NDUFV3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PAPVPAEPFDNTTYKNLQHHDYSTYTFLDLNLELSKFRMPQPSSGRESPR</p>

<p>RBBP7 antibody was raised using the middle region of RBBP7 corresponding to a region with amino acids HWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGH</p>

<p>Mouse monoclonal ARHGAP25 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF258 antibody, catalog no. 70R-8056</p>