Bioquímicos e reagentes

<p>Sulphadiazine Conjugate for use in immunoassays</p>

<p>IRX6 antibody was raised in rabbit using the C terminal of IRX6 as the immunogen</p>

<p>Mouse monoclonal KCNAB1 antibody</p>

<p>C1orf77 antibody was raised using the middle region of C1orf77 corresponding to a region with amino acids LKQSLKQRLGKSNIQARLGRPIGALARGAIGGRGLPIIQRGLPRGGLRGG</p>

<p>RICTOR antibody was raised in Mouse using a purified recombinant fragment of human RICTOR expressed in E. coli as the immunogen.</p>

<p>ISL1 antibody was raised in Mouse using a purified recombinant fragment of human ISL1 expressed in E. coli as the immunogen.</p>

<p>PIWIL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FQELSLAERGGRRRDFHDLGVNTRQNLDHVKESKTGSSGIIVRLSTNHFR</p>

<p>Rabbit Polyclonal cJun antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PDSS1 antibody, catalog no. 70R-2406</p>

<p>Rabbit Polyclonal CHK1 antibody (Ser280)</p>

<p>Rabbit polyclonal CDKN1C antibody</p>

<p>SP6 antibody was raised in rabbit using the C terminal of SP6 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of BOP1 antibody, catalog no. 70R-2410</p>

<p>Mouse monoclonal AMACR antibody (C-terminus)</p>

<p>Donkey anti-human IgG (H + L) (HRP) was raised in donkey using human IgG (H&amp;L) as the immunogen.</p>

<p>Goat anti-human IgG (H+L) (Alk Phos) was raised in goat using human IgG whole molecule as the immunogen.</p>

<p>The CD8 antibody is a monoclonal antibody that plays a crucial role in the immune response. It specifically targets the CD8 protein, which is found on the surface of cytotoxic T cells. This antibody can be used in various life science applications, such as immunoassays and antigen-antibody reactions.</p>

<p>CLCN3 antibody was raised using the C terminal of CLCN3 corresponding to a region with amino acids MESEQLFHRGYYRNSYNSITSASSDEELLDGAGVIMDFQTSEDDNLLDGD</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RAI14 antibody, catalog no. 70R-4242</p>

<p>FABP1 antibody was raised in mouse using recombinant human FABP1 (1-127aa) purified from E. coli as the immunogen.</p>

<p>Mouse monoclonal PKLR antibody</p>

<p>Rabbit polyclonal Kinase E23 antibody</p>

<p>The GHRH Receptor antibody is a specific antibody that targets the growth hormone-releasing hormone (GHRH) receptor. It is a monoclonal antibody that has been extensively studied in the field of Life Sciences. This antibody has shown to have neutralizing effects on the GHRH receptor, inhibiting its activity and downstream signaling pathways.</p>

<p>NCOA1 antibody was raised in Rabbit using Human NCOA1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MAP4K1 antibody, catalog no. 70R-3666</p>

<p>The CRYAB antibody is a highly specialized monoclonal antibody that targets collagen and other binding proteins. It is commonly used in the field of Life Sciences for various applications. This monoclonal antibody has the unique ability to neutralize reactive and activated growth factors, making it an essential tool for researchers studying cell signaling pathways and protein interactions. Additionally, the CRYAB antibody has demonstrated cytotoxic effects on specific cell types, further expanding its potential applications in cancer research. With its high specificity and affinity, this monoclonal antibody can be easily purified using chromatographic techniques, ensuring optimal performance in experiments. Whether you're investigating hepatocyte growth or glycoprotein function, the CRYAB antibody is a valuable asset that will enhance your research outcomes.</p>

<p>Mouse monoclonal PRPS1 antibody</p>

<p>SMC2 antibody was raised using the N terminal of SMC2 corresponding to a region with amino acids ISNLSQVRASNLQDLVYKNGQAGITKASVSITFDNSDKKQSPLGFEVHDE</p>

<p>Purified recombinant Human HSCB Protein (His tag)</p>

<p>Protein C antibody was raised in sheep using human Protein C purified from plasma as the immunogen.</p>

<p>MAGEA10 antibody was raised using the middle region of MAGEA10 corresponding to a region with amino acids NMMGLYDGMEHLIYGEPRKLLTQDWVQENYLEYRQVPGSDPARYEFLWGP</p>

<p>Purified recombinant RAD51B protein (His tag)</p>

<p>Human phos TIE2 (Tyr992) immunogen, Rabbit polyclonal TIE2 antibody</p>

<p>Rabbit polyclonal ELAV2/4 antibody</p>

<p>Rabbit polyclonal NELFA antibody</p>

<p>NARG1L antibody was raised using the middle region of NARG1L corresponding to a region with amino acids ASLKTCDFFSPYENGEKEPPTTLLWVQYFLAQHFDKLGQYSLALDYINAA</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MCTP1 antibody, catalog no. 70R-6254</p>

<p>Beta Lactamase antibody was raised using the middle region of LACTB corresponding to a region with amino acids QEKEGKSNEKNDFTKFKTEQENEAKCRNSKPGKKKNDFEQGELYLREKFE</p>

<p>The PACAP antibody is a proteolytic monoclonal antibody that targets the cyclase-activating peptide (PACAP). It has been shown to exhibit cell cytotoxicity by binding to the conformational epitope of PACAP. This antibody can be used in various applications in the field of Life Sciences, including research on growth factors and as a vaccine adjuvant composition. The PACAP antibody specifically recognizes and binds to PACAP, which is involved in numerous biological processes such as glutamate release and regulation of hormone secretion. Additionally, this antibody has been used in hybridization studies to investigate the expression pattern of PACAP in different tissues. Its ability to modulate cyclase activation makes it a valuable tool for studying signaling pathways mediated by PACAP and its interaction with other molecules such as epidermal growth factor.</p>

<p>Rabbit polyclonal Bax antibody (Thr167)</p>

<p>SHMT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ELIASENFCSRAALEALGSCLNNKYSEGYPGKRYYGGAEVVDEIELLCQR</p>

<p>Rabbit polyclonal RBP4 antibody (HRP)</p>

<p>The PSA antibody is a monoclonal antibody used in the field of Life Sciences. It has the ability to cause lysis in human serum, making it a valuable tool for research and diagnostic purposes. This antibody specifically targets prostate-specific antigen (PSA), a protein that is often elevated in individuals with prostate cancer. By binding to PSA, the antibody can help detect and measure this biomarker in patient samples.</p>

<p>Rabbit polyclonal SCTR antibody</p>

<p>SOCS1 antibody was raised using the middle region of SOCS1 corresponding to a region with amino acids RQRNCFFALSVKMASGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVA</p>

<p>Rabbit polyclonal NDUFA1 antibody</p>

<p>MAK antibody was raised using the C terminal of MAK corresponding to a region with amino acids WNTKTGRGQFSGRTYNPTAKNLNIVNRAQPIPSVHGRTDWVAKYGGHR</p>

<p>SF3B4 antibody was raised using the N terminal of SF3B4 corresponding to a region with amino acids QDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVE</p>

<p>The CD95 antibody is a monoclonal antibody that specifically targets the CD95 protein, also known as Fas or APO-1. This protein is a member of the tumor necrosis factor receptor superfamily and plays a crucial role in apoptosis (programmed cell death). The CD95 antibody recognizes the extracellular domain of CD95 and can be used for various applications, including flow cytometry, immunohistochemistry, and western blotting.</p>

<p>Rabbit polyclonal MRPL35 antibody</p>

<p>G6pc antibody was raised in rabbit using the N terminal of G6pc as the immunogen</p>

<p>ACSBG2 antibody was raised using the middle region of ACSBG2 corresponding to a region with amino acids LNQETAEFFLSLDIPIGELYGLSESSGPHTISNQNNYRLLSCGKILTGCK</p>

<p>The BST1 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets adp-ribosyl cyclase, a key enzyme involved in various cellular processes. This antibody is commonly used for the detection and quantification of recombinant proteins and growth factors in biological samples. It has been extensively validated for use in immunoassays such as ELISA and Western blotting.</p>

<p>Rabbit polyclonal TNXB antibody</p>

<p>Mouse monoclonal MVK antibody</p>

<p>Rabbit polyclonal PPBP antibody (biotin)</p>

<p>GUCY1B3 antibody was raised in Rabbit using Human GUCY1B3 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CLDN17 antibody, catalog no. 70R-1693</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CCNYL1 antibody, catalog no. 70R-5635</p>

<p>Purified Polyclonal Cathepsin H antibody</p>

<p>Toltrazuril Conjugate for use in immunoassays</p>

<p>Rabbit polyclonal MUC16 antibody (HRP)</p>

<p>Affinity purified Rabbit polyclonal PECR antibody</p>

<p>ZFP3 antibody was raised in rabbit using the N terminal of ZFP3 as the immunogen</p>

<p>TMEM48 antibody was raised using the middle region of TMEM48 corresponding to a region with amino acids PPIIKYLALQDLMLLSQYSPSRRQEVFSLSQPGGHPHNWTAISRECLNLL</p>

<p>The GMDS antibody is a highly specific monoclonal antibody that targets the GMDS protein. This proton-neutralizing antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications. It has been found to have cytotoxic effects on cancer cells, particularly when used in combination with sorafenib. Additionally, this antibody has been shown to neutralize the activity of TGF-beta, epidermal growth factor (EGF), and certain chemokines.</p>

<p>The Vav antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets and binds to the recombinant antigen found in c2c12 myotubes. This antibody plays a crucial role in immunoassays by facilitating the antigen-antibody reaction, allowing for accurate detection and measurement of specific proteins or molecules. The Vav antibody is known for its neutralizing properties, making it an essential tool in studying protein kinase signaling pathways and autoantibodies. Its high sensitivity and specificity make it ideal for use in particle chemiluminescence and polymerase chain reactions (PCR). Researchers rely on the Vav antibody to provide reliable results in their studies related to steroid metabolism and other important cellular processes.</p>

<p>Purified recombinant TSFM protein (His tag)</p>

<p>C3orf59 antibody was raised in rabbit using the C terminal of C3orf59 as the immunogen</p>

<p>GRID1 antibody was raised in Rabbit using Human GRID1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MRPL49 antibody, catalog no. 70R-9977</p>

<p>Purified Dog IgG (Fab) HRP conjugate</p>

<p>Elastopar is a potent inhibitor of various kinases, including protein kinase C and mitogen-activated protein kinase. It has been shown to inhibit the growth of tumor cells in vitro and in vivo by inducing apoptosis. Elastopar is an analog of capsaicin, a compound found in chili peppers that has been shown to have anticancer properties. It has been tested on human cancer cell lines, as well as Chinese hamster ovary cells, and has demonstrated significant antitumor activity. Additionally, Elastopar is excreted in urine, making it a potential biomarker for cancer diagnosis and treatment monitoring. This inhibitor shows great promise in the fight against cancer and could be a valuable addition to any anticancer regimen.</p>

<p>Please enquire for more information about Taurocholic acid-d4 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Timentin is a peptide that has been shown to activate receptors, ion channels and ligands. It has also been shown to inhibit the synthesis of protein in cells. Timentin may be used as a research tool for studying the activation of protein-receptor interactions, or as an inhibitor for studying the inhibition of protein synthesis. Timentin is a high purity compound with a CAS number of 86482-18-0.</p>

<p>Penicolinate B is a medicinal compound that has shown potent anticancer properties. It is an analog of a natural product isolated from Chinese herbs and has been found to inhibit the activity of kinases, which are enzymes that play a key role in regulating cell growth and division. Penicolinate B has been shown to induce apoptosis, or programmed cell death, in cancer cells by disrupting the function of certain proteins that are essential for tumor growth. This compound has also demonstrated inhibitory effects on the proliferation of human cancer cells in vitro and in vivo. Additionally, Penicolinate B has been detected in urine samples from patients with cancer, suggesting that it may have potential as a diagnostic tool for detecting early-stage tumors. Overall, Penicolinate B shows promise as a potent inhibitor of kinase activity and a potential anticancer agent.</p>

<p>Please enquire for more information about o-Desisopropyl-o-ethyl bisoprolol-d7 hemifumarate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about PDK1 inhibitor 2610 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Propylparaben-d4 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Atorvastatin (calcium hydrate) is a cell cycle inhibitor that is commonly used in the medicinal field to treat high cholesterol levels. It has also been shown to have anti-cancer properties, inhibiting cell proliferation and inducing cell death in various cancer cell lines. Atorvastatin has been found in human urine and is believed to be derived from Chinese medicinal herbs. This drug works by inhibiting the production of cholesterol in the liver, which helps to reduce the risk of heart disease. Additionally, Atorvastatin can inhibit the activity of certain proteins that are involved in cancer growth, making it a promising candidate for cancer treatment. Overall, Atorvastatin (calcium hydrate) is a versatile medication with potential therapeutic benefits beyond its primary use for cholesterol management.</p>

<p>Please enquire for more information about Benzoic acid-18O2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about AMY-101 (TFA) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 4,4-Methylenebis[3-methyl-phenol] including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>7,8-Dimethoxy-1H-3-benzazepine-2,4(3H,5H)-dione is an analog that has been shown to have anticancer properties. It has been used in Chinese medicinal practices for its ability to induce apoptosis in cancer cells. This compound acts as a kinase inhibitor, specifically targeting protein kinases that are involved in the growth and proliferation of tumor cells. 7,8-Dimethoxy-1H-3-benzazepine-2,4(3H,5H)-dione has been found in human urine and may serve as a potential biomarker for the detection of certain cancers. The inhibition of kinases by this compound has shown promising results in preclinical studies as a potential treatment option for various types of cancer.</p>

<p>5-Oxomefruside is a potent inhibitor of protein kinases that play a crucial role in the cell cycle and cancer cell growth. This compound has been isolated from Chinese urine and is a promising analog for anticancer drug development. 5-Oxomefruside has been shown to induce apoptosis and inhibit tumor growth in human cancer cells, making it a potential candidate for cancer therapy. Additionally, this compound has demonstrated inhibitory activity against elastase, which is involved in tissue damage and inflammation. With its unique properties as a kinase inhibitor and anticancer agent, 5-Oxomefruside holds great potential for future research and development in the field of cancer treatment.</p>

<p>Please enquire for more information about Acrivastine d7 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Eliglustat-d15 tartrate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about rac Dehydro-o-desmethyl venlafaxine-d6 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ravuconazole-d4 is a potent inhibitor of human vitamin K epoxide reductase, an enzyme that is essential for the activation of vitamin K-dependent proteins involved in blood coagulation and bone metabolism. It has been shown to induce apoptosis in tumor cells through the inhibition of protein kinase B (AKT) and mammalian target of rapamycin (mTOR) signaling pathways. Ravuconazole-d4 also exhibits anticancer activity by inhibiting cell cycle progression and inducing apoptosis in various cancer cell lines, including Chinese hamster ovary cells. In addition, this compound has been detected in urine samples from patients receiving ravuconazole therapy, indicating its potential as a biomarker for monitoring drug efficacy or toxicity. Overall, Ravuconazole-d4 holds great promise as a potent inhibitor of tumor growth and a valuable tool for cancer research.</p>

<p>Please enquire for more information about D-Glucitol-2-D including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 1,1-Dichloroethane-d4 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about L-Tryptophan-1-13C including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ACAA2 antibody was raised using the N terminal of ACAA2 corresponding to a region with amino acids ALLRGVFVVAAKRTPFGAYGGLLKDFTATDLSEFAAKAALSAGKVSPETV</p>

<p>Please enquire for more information about BMS 345541 trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about SB 242084 hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 7-(4-Chlorobenzyl)-1,3-dioxohexahydroimidazo[1,5-a]pyrazin-2(3H)-yl2,3-dihydro-4H-benzo[b][1,4]oxazine-4-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Retinyl propionate-d3 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Resolvin D4 is an analog of a protein found in human urine that has been shown to have anticancer properties. It acts as an inhibitor of apoptosis and has been shown to be effective against various cancer cell lines, including those from Chinese hamsters. Resolvin D4 is a potent kinase inhibitor and has been shown to inhibit the activity of luciferase in tumor cells. This compound also has the ability to induce mannitol-induced apoptosis in cancer cells, making it a promising candidate for anticancer therapies. Its unique characteristics make it an exciting area of research for cancer treatment.</p>

<p>R-Doxylamine is a medicinal compound that has been shown to have anticancer properties. It is an inhibitor of kinases, which are enzymes that play an important role in the regulation of cell cycle and apoptosis. R-Doxylamine has been tested on Chinese hamster ovary cells and has shown to inhibit the growth of tumor cells. This compound inhibits protein synthesis and induces apoptosis in cancer cells, making it a promising candidate for the treatment of cancer. In addition, R-Doxylamine has been found in human urine after administration, indicating its potential for use as a therapeutic agent.</p>

<p>Please enquire for more information about (3S)-Besifloxacin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>