Bioquímicos e reagentes

<p>Rabbit Polyclonal eNOS antibody (Ser615)</p>

<p>Purified Rabbit polyclonal OR8H2 antibody</p>

<p>CSF1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAPVAGLTWEDSEGTEGSSLLPGEQPLHTVDPGSAKQRPPRSTCQSFEPP</p>

<p>Purified Polyclonal Fibulin 1 antibody</p>

<p>PSMD11 antibody was raised in mouse using recombinant human PSMD11 (1-422aa) purified from E. coli as the immunogen.</p>

<p>KRR1 antibody was raised in Rabbit using Human KRR1 as the immunogen</p>

<p>Albumin antibody was raised using the middle region of ALB corresponding to a region with amino acids LSEKERQIKKQTALVELVKHKPKATKEQLKAVMDDFAAFVEKCCKADDKE</p>

<p>RAP1GAP antibody was raised using the middle region of RAP1GAP corresponding to a region with amino acids IENIQEVQEKRESPPAGQKTPDSGHVSQEPKSENSSTQSSPEMPTTKNRA</p>

<p>SLC25A12 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLKPAGSEPTPKSRIADLPPANPDHIGGYRLATATFAGIENKFGLYLPKF</p>

<p>1-197 amino acids: MQRASRLKRE LHMLATEPPP GITCWQDKDQ MDDLRAQILG GANTPYEKGV FKLEVIIPER YPFEPPQIRF LTPIYHPNID SAGRICLDVL KLPPKGAWRP SLNIATVLTS IQLLMSEPNP DDPLMADISS EFKYNKPAFL KNARQWTEKH ARQKQKADEE EMLDNLPEAG DSRVHNSTQK RKASQLVGIE KKFHPDVLEH HHHHH</p>

<p>Purified recombinant Human C4BPB protein (His tag)</p>

<p>This antibody reacts with heavy chains on human IgG (gamma chain).</p>

<p>CXorf66 antibody was raised using the middle region of CXorf66 corresponding to a region with amino acids PLYSSHPQNEISPSKPFGPQELAKPPKHFNPKRSVSLGRAALLSNSELAE</p>

<p>Purified recombinant DDX39A protein (His tag)</p>

<p>TRPA1 antibody was raised using the middle region of TRPA1 corresponding to a region with amino acids KCTDRLDEDGNTALHFAAREGHAKAVALLLSHNADIVLNKQQASFLHLAL</p>

<p>GPT2 antibody was raised in Rabbit using Human GPT2 as the immunogen</p>

<p>Purified recombinant SSX1 protein (His tag)</p>

<p>TMED10 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLKPLEVELRRLEDLSESIVNDFAYMKKREEEMRDTNESTNTRVLYFSIF</p>

<p>PSMA3 antibody was raised using a synthetic peptide corresponding to a region with amino acids TCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREE</p>

<p>Purified native Pig Troponin I protein (Skeletal Muscle)</p>

<p>Mouse monoclonal PRKCE antibody</p>

<p>The HSP40 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets and binds to Heat Shock Protein 40 (HSP40), a protein involved in cellular processes such as protein folding and transportation. This antibody recognizes the amino group of HSP40 and can be used for various applications, including immunohistochemistry, Western blotting, and ELISA.</p>

<p>MGMT antibody was raised in Rabbit using Human MGMT as the immunogen</p>

<p>Rat monoclonal CD45RB antibody (PE)</p>

<p>Mouse monoclonal SORD antibody</p>

<p>Mouse monoclonal METTL21A antibody</p>

<p>The Yellow Fever Virus NS1 protein is a key component in the study of yellow fever virus and its effects on the human body. It has been found to have anti-glial fibrillary acidic properties, meaning it can inhibit the growth of glial cells in the brain. Additionally, it has been shown to interact with various receptors and factors in the body, such as the growth hormone receptor and interleukin-6 inhibitory factor. This protein is often used in research and scientific studies related to yellow fever virus, as well as in the development of diagnostic tests and therapies. Monoclonal antibodies targeting this protein have been developed for use in neutralizing the virus and detecting its presence in human serum. Recombinant forms of this protein are also used for various applications in Life Sciences, including conjugated proteins for specific assays. Overall, the Yellow Fever Virus NS1 protein is a crucial tool for understanding and combating yellow fever virus infections.</p>

<p>Mouse RBC antibody was raised in rabbit using murine erythrocytes as the immunogen.</p>

<p>The FGFR1 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and inhibits the growth factor receptor FGFR1, which plays a crucial role in cell growth and proliferation. By blocking the activation of FGFR1, this antibody prevents the downstream signaling pathways that promote cell division.</p>

<p>RBM26 antibody was raised using the middle region of RBM26 corresponding to a region with amino acids PAALKAAQKTLLVSTSAVDNNEAQKKKQEALKLQQDVRKRKQEILEKHIE</p>

<p>Rabbit polyclonal SYT4 antibody</p>

<p>Purified Rabbit polyclonal MOT12 antibody</p>

<p>Rabbit polyclonal MEF2D antibody (Ser444)</p>

<p>The SRR antibody is a monoclonal antibody that is specifically designed for the detection and neutralization of insulin. It is commonly used in research and clinical settings to study hyperinsulinaemic hypoglycaemia, a condition characterized by abnormally high levels of insulin in the blood. The SRR antibody is produced through chemical synthesis or recombinant technology using human insulin as the antigen. It has been extensively validated using techniques such as polymerase chain reaction (PCR) and racemase assays to ensure its specificity and reliability. This monoclonal antibody can be used to detect insulin in various samples, including serum, plasma, and tissue extracts. Additionally, it has been shown to have neutralizing activity against insulin, making it a valuable tool for studying the effects of insulin antibodies and autoantibodies in human insulin preparations. With its high affinity for insulin and ability to recognize specific amino acid residues, the SRR antibody offers precise and accurate results for insulin-related research applications.</p>

<p>The Cry1 antibody is a highly specialized antibody used in Life Sciences research. It specifically targets and binds to the Cry1 protein, which is involved in various cellular processes such as tyrosine phosphorylation and growth factor signaling. This antibody is colloidal gold-conjugated, making it easily detectable in experiments using techniques such as immunohistochemistry or Western blotting.</p>

<p>Affinity purified Goat polyclonal MSR Type 1 antibody</p>

<p>LRRC37A3 antibody was raised using the middle region of LRRC37A3 corresponding to a region with amino acids NYTSTELIIEPEEPSDSSGINLSGFGSEQLDTNDESDVTSTLSYILPYFS</p>

<p>The V5 Tag antibody is a highly reactive monoclonal antibody that is used in the field of Life Sciences. It specifically targets the V5 epitope tag, which is commonly used in protein research and expression studies. This antibody can be used for various applications such as immunoblotting, immunoprecipitation, and immunofluorescence assays.</p>

<p>Rabbit polyclonal Mcleod Syndrome antibody</p>

<p>Purified Rabbit polyclonal CEP41 antibody</p>

<p>Mouse monoclonal MAPK1 antibody</p>

<p>Rabbit polyclonal SDCG1 antibody</p>

<p>KIF19 antibody was raised in Rabbit using Human KIF19 as the immunogen</p>

<p>Rabbit polyclonal FADD antibody (Ser194)</p>

<p>Purified recombinant HGF protein (His tag)</p>

<p>The SOCS3 antibody is a neuroprotective monoclonal antibody that has acidic properties. It is designed to target and bind to fibronectin, insulin, collagen, and other glycosylation sites in the body. This antibody plays a crucial role in regulating the immune response by inhibiting the signaling pathway of cytokines such as interferons and interleukins. By blocking these signals, it helps prevent excessive inflammation and damage to cells and tissues.</p>

<p>DYNLL2 antibody was raised using the N terminal of DYNLL2 corresponding to a region with amino acids MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKY</p>

<p>Rabbit polyclonal POLR2A antibody (Ser1619)</p>

<p>EIF1AX antibody was raised using the middle region of EIF1AX corresponding to a region with amino acids KYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDD</p>

<p>Rac Efavirenz-d4 is a medicinal compound that acts as an analog and inhibitor of kinases, making it a potential anticancer agent. It has been shown to induce apoptosis in cancer cells by inhibiting the activity of protein kinases. Rac Efavirenz-d4 has been studied in Chinese hamster ovary (CHO) cells and human urine samples, where it demonstrated potent tumor inhibition activity. This compound may have potential as a therapeutic agent for various types of cancers due to its ability to target specific proteins involved in cancer cell growth and survival. Additionally, Rac Efavirenz-d4 may have applications beyond cancer treatment, as it has been shown to inhibit other kinase-mediated pathways involved in inflammation and autoimmune diseases.</p>

<p>HSD11B1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHI</p>

<p>FLJ22167 antibody was raised using the N terminal of FLJ22167 corresponding to a region with amino acids CHEAPRARSARAGLPNRLPTALFNSGFWLKRSSYEEQPTVRFQHQVLLVA</p>

<p>The Tyrosine Hydroxylase antibody is a powerful tool used in the field of Life Sciences. It plays a crucial role in various biological processes, including growth factor signaling, phosphatase activity, and binding to nuclear proteins. This monoclonal antibody specifically targets tyrosine hydroxylase, an enzyme involved in the synthesis of important neurotransmitters such as dopamine.</p>

<p>Purified Polyclonal GPR25 antibody</p>

<p>TMEM118 antibody was raised using the N terminal Of Tmem118 corresponding to a region with amino acids HGGHRGGSLLQHVGGDHRGHSEEGGDEQPGTPAPALSELKAVICWLQKGL</p>

<p>FBG3 antibody was raised in rabbit using residues 103-119 (EWKVEDLSRDQRKEFPN) of the human FBG3 protein as the immunogen.</p>

<p>Rabbit polyclonal APC5 antibody (HRP)</p>

<p>Jagged 2 antibody was raised using the N terminal of JAG2 corresponding to a region with amino acids RAQGRGRLPRRLLLLLALWVQAARPMGYFELQLSALRNVNGELLSGACCD</p>

<p>Rabbit polyclonal SLC37A2 antibody</p>

<p>The HUR antibody is a highly specialized monoclonal antibody that has been developed for use in the field of Life Sciences. This antibody is specifically designed to target and neutralize influenza hemagglutinin, a protein found on the surface of the influenza virus. By binding to this protein, the HUR antibody effectively inhibits viral replication and spread.</p>

<p>Purified Polyclonal Caspase 5 p20 antibody</p>

<p>CALCOCO1 antibody was raised in Rabbit using Human CALCOCO1 as the immunogen</p>

<p>GNB3 antibody was raised in Rabbit using Human GNB3 as the immunogen</p>

<p>Cryptosporidium Monoclonal Antibody (FITC)</p>

<p>OATP2/OATP8 antibody was raised in mouse using synthetic N-terminus (24 aa) of human organic anion transporter OATP2 coupled to KLH as the immunogen.</p>

<p>ZNF785 antibody was raised in rabbit using the C terminal of ZNF785 as the immunogen</p>

<p>The Tn antigen antibody is a high-specificity monoclonal antibody that targets the Tn antigen, a unique carbohydrate structure found on certain molecules in the body. This antibody has been extensively studied and proven to have excellent binding affinity for the Tn antigen.</p>

<p>Prosurfactant protein C antibody was raised in rabbit using recombinant fusion protein containing GST and amino acids.. 1-20 from the n-terminal of the human SP-C proprotein as the immunogen.</p>

<p>Rabbit polyclonal Kinase E2 antibody</p>

<p>The ETS1 antibody is a highly specialized monoclonal antibody that has been developed for use in various research applications. It specifically targets and neutralizes the activated form of ETS1, a transcription factor that plays a critical role in regulating gene expression. This antibody has been extensively tested and validated for its specificity and sensitivity.</p>

<p>Purified recombinant PRKACB protein (His tag)</p>

<p>RNASEN antibody was raised using the middle region of RNASEN corresponding to a region with amino acids AAMDALEKYNFPQMAHQKRFIERKYRQELKEMRWEREHQEREPDETEDIK</p>

<p>Recombinant Human MAPK8 protein with His tag</p>

<p>GHRL antibody was raised in Rabbit using Human GHRL as the immunogen</p>

<p>Mouse monoclonal SLC7A8 antibody</p>

<p>FCER1A antibody was raised using the N terminal of FCER1A corresponding to a region with amino acids NPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAK</p>

<p>Purified recombinant NDUFA4 protein (His tag)</p>

<p>Rabbit Polyclonal KIF13B antibody</p>

<p>Mouse monoclonal CDKN3 antibody</p>

<p>Rabbit polyclonal MSK1 antibody</p>

<p>SLC27A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PFSLIRYDVTTGEPIRDPQGHCMATSPGEPGLLVAPVSQQSPFLGYAGGP</p>

<p>The PLK1 antibody is a highly specialized monoclonal antibody that targets the polo-like kinase 1 (PLK1) protein. This antibody has been extensively studied and proven to be effective in various research applications.</p>

<p>Purified Polyclonal Carbonic Anhydrase 2 antibody</p>

<p>Mouse monoclonal PPM1F antibody</p>

<p>Mouse monoclonal AK4 antibody</p>

<p>Mouse monoclonal MGLL antibody</p>

<p>The MHC Class II antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets and neutralizes MHC Class II molecules. These molecules play a crucial role in the immune response by presenting antigens to T cells, thereby initiating an immune response. The MHC Class II antibody can be used in various applications such as immunohistochemistry, flow cytometry, and Western blotting. It has been shown to effectively stain actin filaments, growth factors, collagen, glycoproteins, fibrinogen, and other cellular components. Additionally, this antibody has been used to study the role of MHC Class II molecules in various biological processes including antigen presentation and cytokine production. Its high specificity and affinity make it an essential tool for researchers studying immune responses and related diseases.</p>

<p>The TF antibody is a highly specialized monoclonal antibody that is used for various applications in research and diagnostics. This antibody specifically recognizes the TF antigen, which is a carbohydrate structure found on the surface of cells. The TF antibody can be used in immunoassays, such as ELISA or Western blotting, to detect the presence of TF antigen in samples.</p>

<p>ETV5 antibody was raised in Mouse using a purified recombinant fragment of human ETV5 expressed in E. coli as the immunogen.</p>

<p>This antibody reacts with heavy chains on human IgM (mu chain).</p>

<p>The USP5 antibody is a highly specialized product in the field of Life Sciences. It belongs to the class of neutralizing monoclonal antibodies that target TGF-beta protein. This antibody is specifically designed to bind to and neutralize TGF-beta, a growth factor involved in various cellular processes.</p>

<p>The RBP1 antibody is a growth factor that has been shown to play a role in thrombocytopenia. It is commonly used in Life Sciences research and can be utilized in various experimental techniques, such as electrode-based assays. This trifunctional antibody is capable of binding to human serum and activating specific pathways. It can also be used as a tool for the detection and quantification of other antibodies or antigens. The RBP1 antibody has genotoxic effects on cells, making it useful for studying DNA damage and repair mechanisms. Additionally, it acts as an inhibitor of phosphatase activity and chemokine signaling. This Monoclonal Antibody specifically targets tyrosine kinase receptors and protein kinases, making it an essential tool for researchers in the field of molecular biology.</p>

<p>MMP19 antibody was raised in rabbit using a synthetic peptide corresponding to a region of human MMP-19 as the immunogen.</p>

<p>ADORA3 antibody was raised in rabbit using the C terminal of ADORA3 as the immunogen</p>

<p>ART3 antibody was raised using the middle region of ART3 corresponding to a region with amino acids LEPTQIPAPGPVPVPGPKSHPSASSGKLLLPQFGMVIILISVSAINLFVA</p>

<p>CNP antibody was raised using the middle region of CNP corresponding to a region with amino acids LYSLGNGRWMLTLAKNMEVRAIFTGYYGKGKPVPTQGSRKGGALQSCTII</p>

<p>HNRNPA2B1 antibody was raised in Rabbit using Human HNRNPA2B1 as the immunogen</p>

<p>The LOX antibody is a low-molecular-weight monoclonal antibody with immunosuppressant properties. It contains a cycloalkyl group that specifically targets lipoprotein lipase, an enzyme involved in lipid metabolism. This antibody has the ability to neutralize interferon and other growth factors, making it an effective antiviral agent. Additionally, the LOX antibody has been shown to have a high affinity for alpha-fetoprotein, a marker commonly found in certain types of cancer cells. With its neutralizing capabilities and targeted approach, this monoclonal antibody is a valuable tool in the field of life sciences and holds great potential for therapeutic applications.</p>

<p>Purified recombinant RASSF3 protein (His tag)</p>

<p>Rabbit Polyclonal LEPREL2 antibody</p>