Bioquímicos e reagentes

<p>ELISA kit for the detection of SSA in the research laboratory</p>

<p>Beta 2-Microglobulin is a component of the major histocompatibility complex involving the presentation of peptide antigens to the immune system.</p>

<p>Human sequence expressed in sf Insect Cells; purity &gt;97% by SDS-PAGE and analyzed by silver stain.</p>

<p>Please enquire for more information about Rat AGP ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Human IgD ELISA Kit</p>

<p>Please enquire for more information about Mouse Haptoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>IgY, or immunoglobulin Y, is a type of antibody found in the immune systems of birds, reptiles, and amphibians. It serves a similar function to IgG in mammals. In birds, IgY is the primary antibody found in serum, egg yolk, and other bodily fluids, whereas in mammals, IgG is the predominant antibody. IgY antibodies are important for providing passive immunity to offspring through the transfer of antibodies from the mother to the egg yolk, similar to how mammals transfer antibodies through the placenta or breast milk. IgY antibodies have also been used in research and diagnostic applications due to their specificity and ability to be harvested from egg yolks.</p>

<p>Please enquire for more information about Rat Hemoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Mouse Cystatin C ELISA Kit</p>

<p>The Guinea Pig IgG ELISA kit is intended for the quantitative determination of total guinea pig IgG in biological samples.</p>

<p>VMAT2 antibody was raised in rabbit using a synthetic peptide from C-terminus of rat VMAT2 conjugated to BSA as the immunogen.</p>

<p>ELISA Kit for detection of IgA in the research laboratory</p>

<p>For the quantitative determination of Human leucine-rich alpha-2 glycoprotein 1 (LRG1) in biological samples.</p>

<p>ELISA Kit for detection of Vasopressin in the research laboratory</p>

<p>This Human Transferrin ELISA Kit reacts similarly with apo-transferrin and holo-transferrin.</p>

<p>Guinea Pig IgA ELISA Kit</p>

<p>Please enquire for more information about Human Haptoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Pig IgA ELISA Kit</p>

<p>Please enquire for more information about Human Alpha 1-Antitrypsin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>The Monkey IgA ELISA kit is intended for the quantitative determination of total monkey IgA (new and old world) in biological samples.</p>

<p>Human sequence expressed in CHO Cells; purity &gt;95% by SDS-PAGE and analyzed by silver stain; Fc Fusion Protein.</p>

<p>Bovine Lactoferrin ELISA Kit</p>

<p>Quantify dog hemoglobin in your samples.</p>

<p>Please enquire for more information about Mouse IgE ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Rat A2M ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>This Bovine IgG ELISA kit is intended for the quantitative determination of total bovine IgG. There is no reactivity to human, mouse, rabbit and rat immunoglobulins.</p>

<p>Please enquire for more information about Mouse Hemoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Dog IgM ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Pig IgM ELISA Kit</p>

<p>Rabbit IgM ELISA Kit</p>

<p>The Monkey IgG ELISA kit is intended for the quantitative determination of total monkey IgG (new and old world) in biological samples.</p>

<p>ELISA kit for the detection of EPO in the research laboratory</p>

<p>ELISA Kit for detection of Angiostatin K13 in the research laboratory</p>

<p>GPR116 antibody was raised in Rabbit using Human GPR116 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CSF1 antibody, catalog no. 70R-6326</p>

<p>Purified recombinant nrdD protein (His tag)</p>

<p>Influenza A Calibration Kit for the production of Influenza A Nucleoprotein calibration curve</p>

<p>MOG(35-55) human corresponds to amino acids 35 to 55 of the human myelin oligodendrocyte glycoprotein (MOG). It can be used in multiple sclerosis research to induce experimental autoimmune encephalomyelitis (EAE) in mouse and rat models.</p>

<p>ELISA kit for the detection of Phosphatidyl Serine IgG/IgM in the research laboratory</p>

<p>Rat Beta 2-Microglobulin ELISA Kit<br>Beta 2-Microglobulin is a component of the major histocompatibility complex involving the presentation of peptide antigens to the immune system.</p>

<p>Please enquire for more information about CHO CTSA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mouse SAA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Purified Mouse anti-Human Procalcitonin antibody (Clone 1B12)</p>

<p>Rat Hemopexin ELISA Kit</p>

<p>Human Alpha 1-Acid Glycoprotein (AGP/Orosomucoid) ELISA Kit</p>

<p>Please enquire for more information about Mouse Ferritin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Human Alpha 1-Microglobulin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Rat NGAL ELISA Kit</p>

<p>Please enquire for more information about Mouse IgG2B ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Rat IgA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Horse IgM ELISA Kit</p>

<p>Hamster (CHO) Annexin A5 ELISA Kit<br> <br>Annexin A5 is a host cell protein (HCP) generated by CHO cells during production of biotherapeutics. This process-related impurity accumulates in the extracellular space as it is released from dead CHO cells and secreted from viable cells during cell culture. Annexin A5 is highly immunogenic and may cause dangerous adverse reactions if present in a therapeutic drug formulation.</p>

<p>ELISA kit for detection of Testosterone in the research laboratory</p>

<p>Tetanus toxin antibody is a monoclonal antibody that acts as an inhibitor of the tetanus toxin. It belongs to the class of antibodies known as neutralizing antibodies, which are active agents in the field of life sciences. This monoclonal antibody specifically targets and neutralizes the effects of tetanus toxin by binding to it and preventing it from causing harm. Additionally, this antibody has been shown to have potential therapeutic applications in other areas, such as inhibiting the activity of epidermal growth factor (EGF) and atypical hemolytic autoantibodies. With its versatility and efficacy, this monoclonal antibody offers promising possibilities for medical research and treatment options.</p>

<p>ELISA Kit for detection of IL16 in the research laboratory</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of STAT5B antibody, catalog no. 20R-1134</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ANXA1 antibody, catalog no. 70R-8182</p>

<p>ELISA Kit for detection of Mullerian hormone in the research laboratory</p>

<p>ELISA kit for detection of Serotonin in the research laboratory</p>

<p>ELISA kit for the detection of TRAIL in the research laboratory</p>

<p>ELISA kit for the detection of ssDNA in the research laboratory</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CNDP1 antibody, catalog no. 70R-10125</p>

<p>Rabbit polyclonal virD2 antibody (HRP)</p>

<p>The PDE3B antibody is a protein-based product that belongs to the category of antibodies. It is specifically designed to target and bind to the PDE3B enzyme, which plays a crucial role in various cellular processes. This monoclonal antibody has been extensively tested and validated for its specificity and efficacy.</p>

<p>Rabbit polyclonal POLD2 antibody</p>

<p>PDGFB antibody was raised using the N terminal of PDGFB corresponding to a region with amino acids NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD</p>

<p>Nojirimycin Bisulfite is a potent inhibitor of protein synthesis. It is a receptor-selective ligand that binds to the extracellular domain of the epidermal growth factor (EGF) receptor, thereby inhibiting receptor signaling. Nojirimycin Bisulfite has also been shown to inhibit ion channels and ligand-gated ion channels. Nojirimycin Bisulfite has been shown to bind to both peptides and antibodies, which makes it a useful research tool for studying protein interactions.</p>

<p>Influenza A Antigen Capture ELISA for use in the research laboratory</p>

<p>ELISA kit for the detection of Human Bax in the research laboratory</p>

<p>Tiotropium bromide is a long-acting bronchodilator that is used to relieve the symptoms of asthma and chronic obstructive pulmonary disease. It is a crystalline drug with an extended duration of action. Tiotropium bromide acts by binding to the beta2-adrenergic receptor, which prevents activation of these receptors and inhibits the release of inflammatory mediators. This drug has been shown to be effective for up to 12 months in adults with asthma who are not responsive to standard therapy. Tiotropium bromide does not interact significantly with other drugs, but should be used cautiously in patients with liver impairment or congestive heart failure due to its potential for adverse effects on these organs.</p>

<p>Ac-Ala-Ala-Ala-pNA is a synthetic peptide that is derived from the natural amino acid sequence of cholecystokinin. It has been shown to have high affinity for phospholipid bilayers, which are lipid membranes that form the boundaries of cells and organelles. Ac-Ala-Ala-Ala-pNA can be used as a substrate molecule to study membrane permeability and selectivity in bioreactors. Ac-Ala-Ala-Ala-pNA also acts as a modulator of liposomal membranes, increasing the permeability of these membranes in order to allow more substrate molecules to pass through them.</p>

<p>Mesotocin is a peptide hormone that has a role in the regulation of water permeability and estradiol benzoate. It also regulates the physiological functions of the brain and has been shown to be involved in congestive heart failure, as it causes an increase in blood pressure. Mesotocin is found at high levels in human serum, but its activity is dependent on the presence of other hormones such as estradiol benzoate. The biological properties of mesotocin are largely unknown, although it is known to have receptor activity. The effects of this hormone on the kidney have been studied using mesotocin trifluroacetate (MTFA) and monoclonal antibody (mAb). MTFA causes an increase in glomerular filtration rate (GFR), which may be due to its ability to inhibit angiotensin II-induced vasoconstriction and decrease vascular resistance.</p>

<p>Amyloid beta-Protein (36-38) is a peptide that has molecular weight of 4.3 kDa. It is a fragment of amyloid precursor protein, which is cleaved by enzymes in the brain to create the peptide. Amyloid beta-Protein (36-38) has been found to be involved in Alzheimer's disease as it aggregates into β-sheet bundles and forms amyloid plaques in the brain. This protein can be detected using vibrational spectroscopy and has been observed to have a strain that changes depending on pH. This molecule also undergoes proteolysis by peptidases, which break down proteins into amino acids for analysis with an amino acid analyzer. The solute can be analyzed with an acid analysis or spectrometer, which are used to determine functional groups such as carboxylic acids, hydroxyls, or amides. Amyloid beta-Protein (36-38)</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>05:0 PC is a peptide binding sequence that has been shown to inhibit the replication of viral sequences. 05:0 PC binds to the amino acid sequence in protein, which is a model system for peptide binding. The endoplasmic reticulum, or ER, is the site of synthesis for proteins and its low efficiency may be due to the spontaneous nature of the protein synthesis process. The ER can also be seen as an inhibitor molecule that prevents the virus from replicating. 05:0 PC has been shown to inhibit papillomavirus and HIV-1 replication in vitro. This peptide has also been shown to block interactions between viruses and cells that allow viral replication.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>H-His-Arg-OH is a synthetic peptide that has been shown to have cytotoxic effects on mammalian cells. The H-His-Arg-OH peptide can be used for the treatment of heart disease and autoimmune diseases, such as rheumatoid arthritis. This peptide has been found to be resistant to congestive heart failure, which is caused by a number of factors, including hypertension and valvular stenosis. It has also been shown to have an immunoglobulin G1 (IgG1) genotype.</p>

<p>CJC-1295 is a synthetic peptide, which is an analogue of growth hormone-releasing hormone (GHRH). It is synthesized through recombinant DNA technology, which allows for precise control over its sequence and length. This particular peptide is designed to bind to GHRH receptors in the pituitary gland. By activating these receptors, CJC-1295 stimulates the release of growth hormone (GH) into the bloodstream.The primary function of CJC-1295 is to influence the endocrine system, particularly enhancing the release of endogenous growth hormone. It achieves this by increasing the amplitude and frequency of GH pulses without affecting the natural negative feedback mechanisms that regulate GH production. This mode of action distinguishes CJC-1295 from other growth hormone therapies, as it promotes a more physiological pattern of hormone secretion.CJC-1295 is used in various scientific contexts, primarily in research focusing on growth hormone deficiencies, muscle wasting conditions, and certain metabolic disorders. Its ability to increase GH release also makes it a subject of interest in studies related to aging, tissue repair, and regeneration. The longer half-life of CJC-1295 compared to natural GHRH peptides further enhances its applications in research, allowing for more sustained and controlled experimentation.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Myelin oligodendrocyte glycoprotein (MOG) is a myelin protein found in the central nervous system. MOG is a ligand for CD200, which is an inhibitory receptor expressed by astrocytes. It has been shown that MOG can induce the proliferation and differentiation of primary cultures of rat astrocytes in vitro. MOG induces the production of reactive oxygen species in mitochondria and increases the expression of acid-binding protein, which are both important factors in the demyelination process. MOG has also been implicated as a potential factor in the development of multiple sclerosis. Further research into this protein may lead to new treatments or cures for disorders such as encephalomyelitis, nervous system diseases, or even cancer.</p>