Bioquímicos e reagentes

<p>Hsp27 antibody was raised in mouse using recombinant human Hsp27 (1-205aa) purified from E. coli as the immunogen.</p>

<p>Mouse monoclonal ALDOB antibody</p>

<p>Rat monoclonal TIM1 antibody (biotin)</p>

<p>Goat anti Human IgM mu chain secondary antibody (FITC) (mu chain specific)</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>

<p>The SMAD7 antibody is a monoclonal antibody that targets the protein β-catenin. It has been shown to have inhibitory effects on the natriuretic and growth factor signaling pathways. This antibody specifically binds to interleukin receptors, blocking their activation and downstream signaling. Additionally, it has been found to neutralize the effects of epidermal growth factor and other growth factors involved in cell proliferation and differentiation. The SMAD7 antibody is commonly used in life sciences research for studying cellular signaling pathways and as a tool for investigating the role of β-catenin in various biological processes. With its high specificity and affinity, this antibody is a valuable tool for researchers in the field of molecular biology.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RARA antibody, catalog no. 70R-1301</p>

<p>Rabbit polyclonal Rhombotin 1 antibody (HRP)</p>

<p>WIF1 antibody was raised in Mouse using a purified recombinant fragment of human WIF1 expressed in E. coli as the immunogen.</p>

<p>PSA antibody was raised in mouse using highly pure human Free PSA as the immunogen.</p>

<p>Rabbit polyclonal WRKY65 antibody</p>

<p>Digoxin antibody was raised in mouse using digoxin-BSA as the immunogen.</p>

<p>The Mitochondria antibody is a monoclonal antibody that has neutralizing properties against interferon. It acts by inhibiting the activity of protein kinases and 3-kinase, which are involved in cellular processes such as acetylation and phosphorylation. The antibody is produced through hybridoma cell technology using cellulose as a substrate. It has been shown to react with taxol, a chemotherapy drug used in the treatment of various types of cancer. The Mitochondria antibody is widely used in the field of Life Sciences for research purposes and has proven to be highly effective in studies involving activated cells.</p>

<p>Sheep polyclonal Nitrazepam antibody</p>

<p>Rabbit polyclonal Chl71 antibody</p>

<p>PACRG antibody was raised using the middle region of PACRG corresponding to a region with amino acids GAIMARCNLDHLGSSDPPTSASQVAEIIVNSGDGIDYSQQKRENIGDLIQ</p>

<p>IDH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MMTSVLVCPDGKTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRG</p>

<p>Antithrombin III protein is a crucial component in the field of Life Sciences. It belongs to the group of Proteins and Antigens and is known for its anticoagulant properties. This protein acts as a natural inhibitor of activated clotting factors, thereby preventing excessive blood clot formation. Antithrombin III protein can be used as a therapeutic agent in various medical conditions, such as deep vein thrombosis, pulmonary embolism, and disseminated intravascular coagulation.</p>

<p>Diluent buffer/blocker for use in Poly-HRP enhanced enzymatic labelling of antibodies and antigens. Not biotin-free.</p>

<p>Alpha 2 macroglobulin antibody was raised in goat using human alpha2-macroglobulin as the immunogen.</p>

<p>ADRM1 antibody was raised in rabbit using the C terminal of ADRM1 as the immunogen</p>

<p>MBD4 antibody was raised in Rabbit using Human MBD4 as the immunogen</p>

<p>TPX2 antibody was raised in mouse using recombinant Human Tpx2, Microtubule-Associated, Homolog (Xenopus Laevis) (Tpx2)</p>

<p>Purified Rabbit polyclonal LAT antibody (Tyr171)</p>

<p>Purified recombinant COMMD7 protein (His tag)</p>

<p>Purified native Human TBG protein</p>

<p>Purified recombinant STBD1 protein (His tag)</p>

<p>Purified recombinant CFB protein (His tag)</p>

<p>20-399 amino acids: MRGSHHHHHH GMASMTGGQQ MGRDLYDDDD KDRWGSMEEG LNFPTYDGKD RVVSLSEKNF KQVLKKYDLL CLYYHEPVSS DKVTQKQFQL KEIVLELVAQ VLEHKAIGFV MVDAKKEAKL AKKLGFDEEG SLYILKGDRT IEFDGEFAAD VLVEFLLDLI EDPVEIISSK LEVQAFERIE DYIKLIGFFK SEDSEYYKAF EEAAEHFQPY IKFFATFDKG VAKKLSLKMN EVDFYEPFMD EPIAIPNKPY TEEELVEFVK EHQRPTLRRL RPEEMFETWE DDLNGIHIVA FAEKSDPDGY EFLEILKQVA RDNTDNPDLS ILWIDPDDFP LLVAYWEKTF KIDLFRPQIG VVNVTDADSV WMEIPDDDDL PTAEELEDWI EDVLSGKINT EDDDEDDDDD DNSDEEDNDD SDDDDDE</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections. This active compound exhibits bactericidal activity by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Through various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation, it is metabolized in the body. Rifapentine specifically targets markers expressed by Mycobacterium tuberculosis strains and inhibits their growth. With its proven efficacy and multiple mechanisms of action, this drug offers a promising solution for combating tuberculosis.</p>

<p>This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.</p>

<p>TMEM16A antibody was raised using the middle region of TMEM16A corresponding to a region with amino acids HGFVNHTLSSFNVSDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSENKY</p>

<p>The HDAC3 antibody is a highly specialized monoclonal antibody that acts as a neutralizing agent against the activity of histone deacetylase 3 (HDAC3). It plays a crucial role in regulating gene expression by modifying chromatin structure. The HDAC3 antibody specifically targets and inhibits the enzymatic activity of HDAC3, preventing it from removing acetyl groups from histone proteins. This inhibition leads to increased histone acetylation, resulting in altered gene expression patterns.</p>

<p>Purified Polyclonal OTF3 antibody</p>

<p>The NT5C1A antibody is a polyclonal antibody used in life sciences research. It is specifically designed to target and bind to the NT5C1A protein, which plays a crucial role in various cellular processes. This antibody can be used in experiments involving anti-HER2 antibody, monoclonal antibodies, growth factors, and reaction solutions. Furthermore, it has been shown to have antiangiogenic properties and can inhibit the activity of vascular endothelial growth factor (VEGF), a key regulator of angiogenesis. Additionally, the NT5C1A antibody has been found to be effective in blocking the activation of cardiomyocytes and autoantibodies involved in certain diseases. With its high specificity and reliability, this antibody is an invaluable tool for researchers studying cellular signaling pathways and developing therapeutic interventions.</p>

<p>Mouse monoclonal KCNAB1 antibody</p>

<p>Purified Polyclonal NF kappaB p105 antibody</p>

<p>Rabbit Polyclonal ELOVL5 antibody</p>

<p>Mouse monoclonal SulT1A1 antibody</p>

<p>The TRIM24 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the growth hormone receptor and has been shown to inhibit the activity of this receptor. The TRIM24 antibody is commonly used in studies investigating the role of growth factors, such as trastuzumab, and their interaction with receptors. Additionally, it has been used to study the function of phosphatases and their involvement in cellular signaling pathways. This antibody can be used in various applications, including Western blotting, immunohistochemistry, and flow cytometry. With its high specificity and sensitivity, the TRIM24 antibody is an invaluable tool for researchers studying cell growth and signaling processes.</p>

<p>Rabbit polyclonal MAP2K7 antibody</p>

<p>SIGLEC6 antibody was raised using the N terminal of SIGLEC6 corresponding to a region with amino acids MQGAQEASASEMLPLLLPLLWAGALAQERRFQLEGPESLTVQEGLCVLVP</p>

<p>OR2AT4 antibody was raised using the N terminal of OR2AT4 corresponding to a region with amino acids MDATACNESVDGSPVFYLLGIPSLPETFFLPVFFIFLLFYLLILMGNALI</p>

<p>Mouse monoclonal LIPG antibody</p>

<p>The PRDX3 antibody is a highly specialized product in the field of Life Sciences. It is widely used in various chromatographic techniques and bioassays. This antibody specifically targets nuclear β-catenin, a protein that plays a crucial role in cell signaling and gene expression. The PRDX3 antibody is commonly employed in immunoassays to detect and quantify the levels of β-catenin in biological samples.</p>

<p>IFIH1 antibody was raised in Rabbit using Human IFIH1 as the immunogen</p>

<p>HAAO antibody was raised in Rabbit using Human HAAO as the immunogen</p>

<p>The DCC antibody is a powerful tool for researchers studying kinase signaling pathways. It specifically targets the kinase kinase of the mitogen-activated protein (MAP) kinase pathway, making it an essential component in understanding cellular responses to growth factors and other stimuli. The DCC antibody is available as both monoclonal and polyclonal antibodies, allowing researchers to choose the best option for their specific experiments.</p>

<p>Bovine Red Blood Cells are a vital component in the field of Life Sciences and have various applications, especially in Veterinary Applications. These cells can be used as a fluorophore for imaging studies and other research purposes. The emission properties of Bovine Red Blood Cells make them suitable for use in fluorescence-based assays.</p>

<p>High affinity probe for glucose transporter; photoaffinity label</p>

<p>Rabbit polyclonal LEF1 antibody (Ser42)</p>

<p>Purified recombinant NXPH1 protein (His tag)</p>

<p>HNRNPC antibody was raised in Rabbit using Human HNRNPC as the immunogen</p>

<p>G6PC antibody was raised using the N terminal of G6PC corresponding to a region with amino acids NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM</p>

<p>CLAN antibody was raised in rabbit using N terminus sequence MNFIKDNSRA LIQRMGM of the A and B isoforms of the human CLAN protein as the immunogen.</p>

<p>Il6 protein is an inhibitory factor that belongs to the group of proteins and antigens. It can be used in combination with adalimumab or other inhibitors for therapeutic purposes. Il6 protein has been shown to have chemokine and epidermal growth factor properties, as well as anti-VEGF (vascular endothelial growth factor) and neutralizing effects on TNF-α (tumor necrosis factor-alpha). It also exhibits activity against interleukins and interferons. Additionally, Il6 protein has carbonic properties and can be used in conjugated proteins for various applications, including the treatment of endothelial growth disorders.</p>

<p>Purified Polyclonal EDG3 antibody</p>

<p>Recombinant Human PICK1 protein (His tag)</p>

<p>Purified recombinant GDI2 protein (His tag)</p>

<p>MDVFMKGLSK AKEGVVAAAE KTKQGVAEAA GKTKEGVLYV GSKTKEGVVH GVATVAEKTK EQVTNVGGAV VTGVTAVAQK TVEGAGSIAA ATGFV</p>

<p>SOX12 antibody was raised in mouse using recombinant Human Sry (Sex Determining Region Y)-Box 12</p>

<p>The Cytochrome P450 2D6 antibody is a highly specialized monoclonal antibody that has the unique ability to neutralize the activity of the Cytochrome P450 2D6 enzyme. This enzyme plays a crucial role in drug metabolism and can affect the efficacy and safety of various medications.</p>

<p>MRPL28 antibody was raised in Rabbit using Human MRPL28 as the immunogen</p>

<p>Rabbit polyclonal SEC61A1 antibody</p>

<p>Rabbit Polyclonal OR2A7 antibody</p>

<p>ASB6 antibody was raised using the middle region of ASB6 corresponding to a region with amino acids LKMAELGLTRAADVLLRHGANLNFEDPVTYYTALHIAVLRNQPDMVELLV</p>

<p>AD80 is a multi-kinase inhibitor that prevents the phosphorylation and activation of tyrosine kinases. It has been shown to inhibit the proliferation of leukemia cells in vivo. AD80 has been found to be effective against glioblastoma cells and other cancer types, such as melanoma, breast cancer, and lung cancer. AD80 inhibits protein synthesis by binding to the ATP-binding site of the enzyme kinase domain. The solubility data for AD80 shows that it is highly soluble in water and organic solvents.</p>

<p>Calicin antibody was raised using the C terminal of CCIN corresponding to a region with amino acids TTSVPVLPNSCPLDVSHAICSIGDSKVFVCGGVTTASDVQTKDYTINPNA</p>

<p>Rabbit polyclonal SCN1B antibody</p>

<p>Purified Polyclonal CACNG1 antibody</p>

<p>BRCA2 (pSer3291)</p>

<p>Amyloid P-IN-1 is a ligand that binds to the amyloid peptide and inhibits the formation of amyloids. Amyloid P-IN-1 has been shown to be an orally active molecule in humans, with a low oral bioavailability due to its physicochemical properties. The affinity for amyloid P-IN-1 to bind to the amyloid peptide is high and it has been shown to inhibit the growth of amyloids in vitro and in vivo. Amyloid P-IN-1 also has pharmacological effects on ligands, such as binding to receptors on cells, which may account for its potential use as a therapeutic agent.</p>

<p>Mouse monoclonal MAPK8 antibody</p>

<p>PIGA antibody was raised using the middle region of PIGA corresponding to a region with amino acids SVKSLCEGLEKAIFQLKSGTLPAPENIHNIVKTFYTWRNVAERTEKVYDR</p>

<p>WWP2 antibody was raised using the middle region of WWP2 corresponding to a region with amino acids TKTTTWERPLPPGWEKRTDPRGRFYYVDHNTRTTTWQRPTAEYVRNYEQW</p>

<p>MSTN antibody was raised in Rabbit using Human MSTN as the immunogen</p>

<p>Sheep polyclonal Ritodrine antibody</p>

<p>The NEU2 antibody is a highly specialized monoclonal antibody that has a range of unique characteristics. It exhibits colloidal properties, making it an excellent choice for various applications. This antibody has been proven to have antiviral properties and can effectively neutralize the activity of specific viruses. Additionally, the NEU2 antibody is capable of binding to autoantibodies, providing potential therapeutic benefits in autoimmune disorders.</p>

<p>Mouse monoclonal MTFMT antibody</p>

<p>HOMEZ antibody was raised in rabbit using the N terminal of HOMEZ as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GFM2 antibody, catalog no. 70R-10104</p>

<p>1-181 amino acids: MGSSHHHHHH SSGLVPRGSH MESKEPQLKG IVTRLFSQQG YFLQMHPDGT IDGTKDENSD YTLFNLIPVG LRVVAIQGVK ASLYVAMNGE GYLYSSDVFT PECKFKESVF ENYYVIYSST LYRQQESGRA WFLGLNKEGQ IMKGNRVKKT KPSSHFVPKP IEVCMYREQS LHEIGEKQGR SRKSSGTPTM NGGKVVNQDS T</p>

<p>The CD10 antibody is a monoclonal antibody that targets the CD10 protein, which is also known as neutral endopeptidase. This protein plays a crucial role in the degradation of extracellular matrix components such as collagen and acts as a kinase inhibitor. The CD10 antibody has been widely used in Life Sciences research to study various biological processes.</p>

<p>This antibody reacts with heavy (gamma) chains on rat IgG and light chains on all rat immunoglobulins.</p>

<p>The SYNCRIP antibody is a highly specialized antibody used in the field of Life Sciences. It is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific needs. This antibody has been extensively tested and shown to be effective in detecting SYNCRIP proteins in human serum samples.</p>

<p>MFAP4 antibody was raised using the N terminal of MFAP4 corresponding to a region with amino acids TEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQNMHLLTLK</p>

<p>REEP1 antibody was raised using the middle region of REEP1 corresponding to a region with amino acids AKDRSYDALVHFGKRGLNVAATAAVMAASKGQGALSERLRSFSMQDLTTI</p>

<p>The GPR87 antibody is a highly effective polyclonal antibody that specifically targets G-protein coupled receptor 87 (GPR87). This antibody has the ability to neutralize the activity of GPR87, which is known to play a crucial role in various cellular processes. It has been shown to inhibit the epidermal growth factor (EGF) signaling pathway, making it an excellent candidate for therapeutic applications in cancer treatment. Additionally, this antibody has shown promising results as a potential anti-HER2 antibody, further highlighting its versatility and effectiveness. With its ability to bind to interferon-gamma (IFN-gamma) and other growth factors, the GPR87 antibody offers a wide range of applications in the field of life sciences. Whether used as a research tool or for therapeutic purposes, this antibody is a valuable asset for scientists and researchers alike.</p>

<p>Purified Rabbit polyclonal MRPL50 antibody</p>

<p>N-[3-[(2R,3R)-5-Amino-3,6-dihydro-3-methyl-2-(trifluoromethyl)-2H-1,4-oxazin-3-yl]-4-fluorophenyl]-5-cyano-2-pyridinecarboxamide is a high purity chemical compound that is used in research. CAS No. 1352416-78-4 is an antibody that binds to the receptor of the ion channels and can be used as a research tool. The ligand is an inhibitor or activator of the protein interactions. This reagent has been shown to be useful for the study of cell biology and pharmacology.</p>

<p>OXCT1 antibody was raised using the N terminal of OXCT1 corresponding to a region with amino acids TLAERIRAGGAGVPAFYTPTGYGTLVQEGGSPIKYNKDGSVAIASKPREV</p>

<p>Rabbit polyclonal USP34 antibody</p>

<p>RAB27A antibody was raised using the middle region of RAB27A corresponding to a region with amino acids SQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACG</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NKAIN1 antibody, catalog no. 70R-7160</p>

<p>The C1S antibody is a potent monoclonal antibody that belongs to the class of neutralizing antibodies. It is widely used in the field of Life Sciences for various applications. This antibody specifically targets and neutralizes C1S, a protease involved in the complement system. By inhibiting C1S activity, this antibody can modulate immune responses and prevent excessive inflammation. Additionally, this monoclonal antibody has been shown to have mitogenic properties, stimulating cell growth and proliferation in various cell types such as dopamine-producing cells and collagen-producing cells. Furthermore, it has been used in research studies to enhance the oncolytic activity of adenoviruses and inhibit protease activity at low pH levels. The C1S antibody is a valuable tool for researchers studying hepatocyte growth and activation pathways.</p>

<p>Mouse monoclonal KIAA1609 antibody</p>

<p>Mouse monoclonal SPG7 antibody</p>

<p>Rabbit polyclonal LATS2 antibody</p>

<p>Rabbit polyclonal Adiponectin antibody (HRP)</p>

<p>VSV-G antibody was raised in goat using VSV-G (YTDIEMNRLGK) conjugated to KLH as the immunogen.</p>