Bioquímicos e reagentes

<p>MFN1 antibody was raised in Rabbit using Human MFN1 as the immunogen</p>

<p>EXOSC10 antibody was raised using the middle region of EXOSC10 corresponding to a region with amino acids ACKAAAEQAISVRQQVVLENAAKKRERATSDPRTTEQKQEKKRLKISKKP</p>

<p>Rabbit polyclonal ERK3 antibody (Ser189)</p>

<p>1-105 amino acids: MGSSHHHHHH SSGLVPRGSH MVKQIESKTA FQEALDAAGD KLVVVDFSAT WCGPCKMIKP FFHSLSEKYS NVIFLEVDVD DCQDVASECE VKCMPTFQFF KKGQKVGEFS GANKEKLEAT INELV</p>

<p>Rabbit polyclonal p70 S6 Kinase beta antibody (Ser423)</p>

<p>RBM9 antibody was raised using the middle region of RBM9 corresponding to a region with amino acids TAAAAAAAAYSDGYGRVYTADPYHALAPAASYGVGAVASLYRGGYSRFAP</p>

<p>The ADRB3 antibody is a highly specialized antibody used in the field of Life Sciences. It is a polyclonal antibody that targets the adrenergic receptor beta-3 (ADRB3), which plays a crucial role in various physiological processes such as adipose tissue metabolism and regulation of energy expenditure. This antibody has been extensively studied and proven to have neutralizing properties against ADRB3, making it an essential tool for researchers studying growth factors, alpha-fetoprotein, and other related molecules.</p>

<p>Rabbit polyclonal DAPP1 antibody (Tyr139)</p>

<p>FBG2 antibody was raised in rabbit using residues 268-284 (SEAQPGQKHGQEEAAQS) of the human FBG2 protein as the immunogen.</p>

<p>UBE2C antibody was raised using the middle region of UBE2C corresponding to a region with amino acids QGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNP</p>

<p>IKZF3 antibody was raised in Rabbit using Human IKZF3 as the immunogen</p>

<p>Purified Polyclonal GNL1 antibody</p>

<p>Mouse anti Human IgG4 pFC antibody - HRP conjugate</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of EVX2 antibody, catalog no. 70R-9601</p>

<p>Rabbit polyclonal SLC19A3 antibody</p>

<p>Rabbit polyclonal OLFML2B antibody</p>

<p>Triiodothyronine antibody was raised in mouse using triiodothyronine-BSA as the immunogen.</p>

<p>Rabbit polyclonal PDGFRa antibody (Tyr849)</p>

<p>MKL1 antibody was raised in rabbit using the C terminal of MKL1 as the immunogen</p>

<p>The Collagen Type IV antibody is a powerful tool in the field of Life Sciences. Produced by hybridoma cells, this antibody specifically targets collagen, a vital component of connective tissues. It has been shown to have inhibitory effects on helicobacter growth and can be used to detect autoantibodies in various diseases. Additionally, the Collagen Type IV antibody can be utilized as a substrate for siRNA delivery or as an anti-connexin agent. With its high specificity and affinity, this monoclonal antibody is widely used in research laboratories for studying endothelial growth and the role of collagen in various biological processes.</p>

<p>TNFSF12 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets and binds to the TNFSF12 molecule, which is involved in various biological processes such as cell growth, differentiation, and immune response. This antibody has been extensively studied and shown to effectively block the activity of TNFSF12, thereby modulating its downstream effects.</p>

<p>Rabbit polyclonal CBX6 antibody</p>

<p>BMP7 antibody was raised in rabbit using highly pure recombinant human BMP-7 as the immunogen.</p>

<p>Purified Polyclonal GUCY1B3 antibody</p>

<p>Mouse anti-goat IgG (H + L) (HRP) was raised in mouse using goat IgG (H &amp; L) as the immunogen.</p>

<p>Rabbit polyclonal GPR27 antibody</p>

<p>RNF139 antibody was raised using the N terminal of RNF139 corresponding to a region with amino acids SQRSLFKFYTYSSAFLLAATSVLVNYYASLHIDFYGAYNTSAFGIELLPR</p>

<p>The Elastin antibody is a neutralizing inhibitor that is widely used in Life Sciences research. It specifically targets protein kinases involved in the regulation of TGF-beta signaling pathway, P2X receptors, and collagen synthesis. This antibody has been shown to effectively block the activation of these proteins, preventing the downstream effects such as proton release, superoxide production, and chemokine secretion. Additionally, the Elastin antibody is commonly used for immunohistochemistry and immunofluorescence experiments to detect elastin expression in various tissues and cell types. It is a polyclonal antibody derived from animals and exhibits high specificity and sensitivity. Researchers often rely on this antibody to study the role of elastin in various biological processes and its potential as a therapeutic target for conditions related to mesenchymal stem cells dysfunction.</p>

<p>GCOM1 antibody was raised using the middle region of Gcom1 corresponding to a region with amino acids VAQVENQLLKMKVESSQEANAEVMREMTKKLYSQYEEKLQEEQRKHSAEK</p>

<p>Purified Rabbit polyclonal CD32 antibody (Tyr292)</p>

<p>Soporidine is an inhibitor of protein interactions, which is used in the study of receptor-ligand interactions. Soporidine has been shown to activate some receptors and inhibit others. It has also been shown to be a potent inhibitor of ion channels and may be useful as a research tool for studying ion channel function.</p>

<p>RTCD1 antibody was raised using the N terminal of RTCD1 corresponding to a region with amino acids VQKIRAGRSTPGLRPQHLSGLEMIRDLCDGQLEGAEIGSTEITFTPEKIK</p>

<p>Rabbit polyclonal alpha Synuclein antibody (Tyr136)</p>

<p>Mouse monoclonal EPSP synthase antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KLHL8 antibody, catalog no. 70R-8348</p>

<p>NANP antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Rabbit polyclonal RPL26L antibody</p>

<p>DUSP10 antibody was raised using the N terminal of DUSP10 corresponding to a region with amino acids MQRLNIGYVINVTTHLPLYHYEKGLFNYKRLPATDSNKQNLRQYFEEAFE</p>

<p>The EMA antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and bind to fibrinogen, a glycoprotein involved in blood clotting. This antibody is produced using hybridoma cell lines, which are created by fusing immune cells with tumor cells. The resulting hybridoma cells have the ability to produce large quantities of the EMA antibody.</p>

<p>Recombinant Human tnaa protein (His tag)</p>

<p>Carboxypeptidase B1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SRVRATGHSYEKYNKWETIEAWTQQVATENPALISRSVIGTTFEGRAIYL</p>

<p>Rabbit polyclonal RNPEP antibody</p>

<p>Zfp161 antibody was raised in rabbit using the middle region of Zfp161 as the immunogen</p>

<p>The APPL1 antibody is a highly specific and potent antibody that can be used for various applications in research and diagnostics. It is available as both polyclonal and monoclonal antibodies, providing flexibility for different experimental needs.</p>

<p>1-72 amino acids: MRGSHHHHHH GMASMTGGQQ MGRDLYDDDD KDRWGSHMAG IELERCQQQA NEVTEIMRNN FGKVLERGVK LAELQQRSDQ LLDMSSTFNK TTQNLAQKKC WENIRYRIC</p>

<p>Purified recombinant PRKAB2 protein</p>

<p>The GRK2 antibody is a highly specialized protein that plays a crucial role in regulating the growth factor signaling pathway. It specifically targets trastuzumab, an EGF-like growth factor, and inhibits its activity by binding to it. This monoclonal antibody acts as a proton pump inhibitor, preventing the release of protons from collagen and thereby reducing collagen-induced cytotoxicity. Additionally, the GRK2 antibody has been shown to inhibit chemokine signaling and enhance the efficacy of other antibodies such as sorafenib and doxorubicin. In the field of life sciences, this antibody is widely used in research and development for studying TGF-beta signaling pathways. With its unique characteristics and versatile applications, the GRK2 antibody is an essential tool for scientists and researchers in various disciplines.</p>

<p>Recombinant Human ZFAND5 protein (His tag)</p>

<p>1-259 amino acids: MSKYKLIMLR HGEGAWNKEN RFCSWVDQKL NSEGMEEARN CGKQLKALNF EFDLVFTSVL NRSIHTAWLI LEELGQEWVP VESSWRLNER HYGALIGLNR EQMALNHGEE QVRLWRRSYN VTPPPIEESH PYYQEIYNDR RYKVCDVPLD QLPRSESLKD VLERLLPYWN ERIAPEVLRG KTILISAHGN SSRALLKHLE GISDEDIINI TLPTGVPILL ELDENLRAVG PHQFLGDQEA IQAAIKKVED QGKVKQAKKL EHHHHHH</p>

<p>GNAQ antibody was raised in Rabbit using Human GNAQ as the immunogen</p>

<p>Tetraspanin 17 antibody was raised using the N terminal of TSPAN17 corresponding to a region with amino acids GVMSVLGFAGCIGALRENTFLLKFFSVFLGLIFFLELATGILAFVFKDWI</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SUZ12 antibody, catalog no. 70R-7933</p>

<p>PRTFDC1 antibody was raised using the N terminal of PRTFDC1 corresponding to a region with amino acids AGSSEEAPDYGRGVVIMDDWPGYDLNLFTYPQHYYGDLEYVLIPHGIIVD</p>

<p>TMEM16C antibody was raised using the C terminal of TMEM16C corresponding to a region with amino acids  AFVIAITSDYIPRFVYEYKYGPCANHVEPSENCLKGYVNNSLSFFDLSEL</p>

<p>The TAU antibody is a highly specialized Polyclonal Antibody that targets and interacts with the tau protein, a key component of the neurofibrillary tangles found in Alzheimer's disease and other tauopathies. This antibody is specifically designed to recognize and bind to tau proteins in various biological samples, including brain tissue sections, cell lysates, and cerebrospinal fluid.</p>

<p>RBBP7 antibody was raised using the N terminal of RBBP7 corresponding to a region with amino acids MTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVH</p>

<p>NDST4 antibody was raised using a synthetic peptide corresponding to a region with amino acids YLFLLMHPSIISNLPSPKTFEEVQFFNGNNYHKGIDWYMDFFPTPSNTTS</p>

<p>Conjugated Barbital-BSA hapten</p>

<p>APC protein antibody was raised in Rat using GST fusion protein having the APC region B as the immunogen.</p>

<p>The eNOS antibody is a highly specialized biomolecule that plays a crucial role in various biological processes. This glycoprotein is activated to neutralize the effects of myelin-associated glycoprotein, which is involved in nerve cell regeneration and repair. The eNOS antibody belongs to the class of polyclonal antibodies, making it highly effective in targeting specific antigens. It has been found to be particularly effective against autoantibodies that target collagen, a key component of connective tissues.</p>

<p>Rabbit polyclonal p18 INK antibody</p>

<p>MGP antibody was raised using the middle region of MGP corresponding to a region with amino acids INRRNANTFISPQQRWRAKVQERIRERSKPVHELNREACDDYRLCERYAM</p>

<p>Purified Polyclonal Ephrin B3 antibody</p>

<p>BRDU antibody was raised in sheep using highly pure bromodeoxyuridine as the immunogen.</p>

<p>OVA conjugated Ciprofloxacin Hapten</p>

<p>KLHL20 antibody was raised in Rabbit using Human KLHL20 as the immunogen</p>

<p>MRPL23 antibody was raised in Rabbit using Human MRPL23 as the immunogen</p>

<p>SNX5 protein is a multifunctional protein that plays a crucial role in various biological processes. It has been shown to be involved in the regulation of interferon signaling, pneumococcus infection, and growth factor signaling pathways such as TGF-beta. SNX5 protein can be targeted by monoclonal antibodies, including neutralizing antibodies, which can inhibit its activity. Additionally, it has been found to interact with other proteins such as carbonic anhydrase and globulin.</p>

<p>The CRYAB antibody is a highly effective tool for research in the field of Life Sciences. It is specifically designed to target and bind to CRYAB, a protein that plays a crucial role in various cellular processes. This antibody can be used to study the activation of CRYAB in response to different stimuli, as well as its interactions with other proteins and molecules.</p>

<p>PIGQ antibody was raised using the N terminal of PIGQ corresponding to a region with amino acids VLHFPFIPIQVKQLLAQVRQASQVGVAVLGTWCHCRQEPEESLGRFLESL</p>

<p>Rabbit polyclonal PRIM1 antibody</p>

<p>Rabbit polyclonal TBX22 antibody</p>

<p>Rabbit polyclonal TMOD3 antibody</p>

<p>HNRNPUL1 antibody was raised in Rabbit using Human HNRNPUL1 as the immunogen</p>

<p>DCXR antibody was raised using the middle region of DCXR corresponding to a region with amino acids STKGALDMLTKVMALELGPHKIRVNAVNPTVVMTSMGQATWSDPHKAKTM</p>

<p>Rabbit polyclonal Chl50 antibody</p>

<p>The CTNNB1 antibody is a monoclonal antibody that specifically targets the CTNNB1 protein. This protein plays a crucial role in various cellular processes, including cell adhesion, signal transduction, and gene expression. The CTNNB1 antibody has been extensively studied and shown to be highly specific and sensitive in detecting CTNNB1 in various biological samples.</p>

<p>JAKMIP1 antibody was raised in Rabbit using Human JAKMIP1 as the immunogen</p>

<p>TPP1 antibody is a highly specialized antibody used in the field of Life Sciences. It is an antiviral antibody that specifically targets brain natriuretic peptide (BNP). This monoclonal antibody has been developed using advanced spectrometric techniques and is activated to exhibit high affinity and specificity for BNP. TPP1 antibody can be used in various research applications, such as immunoassays and western blotting, to detect and quantify BNP levels. It is produced using state-of-the-art manufacturing processes, ensuring high purity and quality. With its exceptional performance, TPP1 antibody is a valuable tool for scientists studying the role of BNP in various physiological processes.</p>

<p>1-172 amino acids: MRGSHHHHHH GMASMTGGQQ MGRDLYDDDD KDRWGSHMMI IYRDLISHDE MFSDIYKIRE IADGLCLEVE GKMVSRTEGN IDDSLIGGNA SAEGPEGEGT ESTVITGVDI VMNHHLQETS FTKEAYKKYI KDYMKSIKGK LEEQRPERVK PFMTGAAEQI KHILANFKNY QFFIGENMNP DGMVALLDYR EDGVTPYMIF FKDGLEMEKC</p>

<p>Goat anti-human IgG (H + L) (HRP) was raised in goat using hamster IgG (H &amp; L) as the immunogen.</p>

<p>The Estriol antibody is a specific antibody used in Life Sciences research. It is commonly used to detect and measure the levels of estriol, a hormone produced during pregnancy. This antibody can be used in various applications such as immunohistochemistry, western blotting, and ELISA assays. The Estriol antibody has been shown to have high affinity and specificity for estriol, making it a reliable tool for researchers studying hormone regulation. Additionally, this antibody has been used in studies investigating the role of estriol in dopamine signaling, liver microsomes, leukemia inhibitory factor (LIF), interleukin-6 (IL-6), β-catenin inhibitors, oncostatin, and protein kinase pathways. With its versatility and accuracy, the Estriol antibody is an essential tool for scientists conducting hormonal research.</p>

<p>PIGT antibody was raised using the C terminal of PIGT corresponding to a region with amino acids LPANSVTKVSIQFERALLKWTEYTPDPNHGFYVSPSVLSALVPSMVAAKP</p>

<p>Rat monoclonal IL13 antibody (biotin)</p>

<p>Purified Polyclonal EHHADH antibody</p>

<p>GLO1 antibody was raised in Rabbit using Human GLO1 as the immunogen</p>

<p>Rabbit polyclonal SH1 antibody (Tyr536)</p>

<p>GPR132 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Rabbit polyclonal M3K13 antibody</p>

<p>DACH2 antibody was raised in rabbit using the C terminal of DACH2 as the immunogen</p>

<p>Mouse monoclonal NRBP1 antibody</p>

<p>C21ORF62 antibody was raised using the middle region of C21Orf62 corresponding to a region with amino acids STNTLPTEYLAICGLKRLRINMEAKHPFPEQSLLIHSGGDSDSREKPMWL</p>

<p>Mouse monoclonal PLEKHA3 antibody</p>

<p>The HK2 antibody is a growth factor that belongs to the class of monoclonal antibodies. It specifically targets and neutralizes interleukin-6 (IL-6), a protein involved in various inflammatory processes. This monoclonal antibody has been extensively studied in the field of life sciences and has shown promising results in inhibiting the activity of IL-6, thereby reducing inflammation. In addition to its anti-inflammatory properties, the HK2 antibody has also been found to have cytotoxic effects on certain cells, particularly those expressing collagen and fibrinogen. This makes it a potential therapeutic option for conditions involving abnormal cell growth or tissue remodeling. Its ability to bind to actin filaments and glycoproteins further enhances its efficacy as a targeted therapy.</p>

<p>IL3RA antibody was raised in Rabbit using Human IL3RA as the immunogen</p>

<p>Recombinant Human CD70 protein (His tag)</p>

<p>The BTN1A1 antibody is a diagnostic agent used in Life Sciences research. It is a monoclonal antibody that specifically targets the BTN1A1 protein. This protein plays a crucial role in regulating tartrate-resistant acid phosphatase (TRAP) activity, which is important for bone remodeling and osteoclast function. The BTN1A1 antibody can be used in bioassays to detect the presence of BTN1A1 protein in samples, making it a valuable tool for studying bone metabolism and related disorders. Its high specificity and sensitivity make it an ideal choice for researchers working in the field of bone biology and diagnostics.</p>

<p>HOXB1 antibody was raised in Rabbit using Human HOXB1 as the immunogen</p>

<p>Rabbit Polyclonal ATF2 antibody (Ser112or94)</p>

<p>Purified recombinant SERPINC1 protein (His tag)</p>