Bioquímicos e reagentes

<p>GLPG 0974 is an experimental pharmaceutical compound, specifically an antagonist of the free fatty acid receptor 2 (FFA2), also known as GPR43. This compound is synthesized through a process of chemical engineering aimed at selectively inhibiting GPR43's activity. The mode of action involves blocking the interaction of short-chain fatty acids with GPR43, a receptor implicated in inflammatory pathways.</p>

<p>Rabbit polyclonal SLC1A4 antibody</p>

<p>HDLBP antibody was raised using a synthetic peptide corresponding to a region with amino acids RLEHDVNIQFPDKDDGNQPQDQITITGYEKNTEAARDAILRIVGELEQMV</p>

<p>RABL4 antibody was raised using the C terminal of RABL4 corresponding to a region with amino acids RAWALGQGLECFETSVKEMENFEAPFHCLAKQFHQLYREKVEVFRALA</p>

<p>KIR2DS4 antibody was raised in Rabbit using Human KIR2DS4 as the immunogen</p>

<p>Rabbit polyclonal RPL40 antibody</p>

<p>TRIM72 antibody was raised using the middle region of TRIM72 corresponding to a region with amino acids LEELTFDPSSAHPSLVVSSSGRRVECSEQKAPPAGEDPRQFDKAVAVVAH</p>

<p>Rabbit polyclonal OR2H2 antibody</p>

<p>MAGOH antibody was raised in Rabbit using Human MAGOH as the immunogen</p>

<p>Mouse lymphocyte antibody was raised in rabbit using RBC-free rannit thymus and spleen cells as the immunogen.</p>

<p>Rabbit polyclonal SRF antibody (Ser77)</p>

<p>The Glycogen Synthase antibody is a growth factor that plays a crucial role in various biological processes. It belongs to the class of antibodies and binding proteins that are involved in immunomodulation. This antibody has been shown to have cytotoxic and antiviral properties, making it a potential candidate for the development of anticancer agents and antiviral therapies. The Glycogen Synthase antibody can neutralize specific targets by binding to specific epitopes on their surface, thereby inhibiting their activity. With its polyclonal and monoclonal variants, this antibody offers a wide range of applications in Life Sciences research and clinical settings.</p>

<p>The KLF4 antibody is a powerful tool used in Life Sciences for ultrasensitive detection and analysis. It is designed to specifically target and bind to the KLF4 protein, which plays a crucial role in cell growth and development. This monoclonal antibody can be used in various applications such as immunoassays, Western blotting, and immunohistochemistry.</p>

<p>KIFAP3 antibody was raised using the middle region of KIFAP3 corresponding to a region with amino acids WLEMVESRQMDESEQYLYGDDRIEPYIHEGDILERPDLFYNSDGLIASEG</p>

<p>Armenian Hamster monoclonal CD95 Ligand antibody (PE)</p>

<p>Mouse monoclonal KATNB1 antibody</p>

<p>INPP5J antibody was raised in Rabbit using Human INPP5J as the immunogen</p>

<p>Rabbit polyclonal ARHGAP15 antibody</p>

<p>Mouse monoclonal HAV2C antibody</p>

<p>ARR3 antibody was raised in rabbit using the middle region of ARR3 as the immunogen</p>

<p>PARK7 antibody was raised in rabbit using residues 167-189 (AIVEALNGKEVAAQVKAPLVLKD) of human PARK7 (DJ-1) as the immunogen.</p>

<p>LCK antibody was raised using the N terminal of LCK corresponding to a region with amino acids PSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKANSLE</p>

<p>The BTK antibody is a monoclonal antibody used in Life Sciences research. It targets the growth factor receptor BTK (Bruton's tyrosine kinase) and inhibits its activity. This antibody has been shown to have potential therapeutic applications in various diseases, including cancer and autoimmune disorders. It can be used in combination with other drugs like metoclopramide, insulin, thymidylate, domperidone, trastuzumab, and natriuretic peptides to enhance their efficacy. Additionally, the BTK antibody has demonstrated the ability to block epidermal growth factor signaling and neutralize autoantibodies. Its acidic nature allows for efficient binding to specific target sites, making it a valuable tool in scientific research and drug development.</p>

<p>The SQSTM1 antibody is a highly specialized monoclonal antibody that is used for immobilization and detection of SQSTM1 protein. It specifically targets and binds to the SQSTM1 protein, allowing for its easy detection and analysis in various biological samples. This antibody is widely used in research laboratories and diagnostic settings to study the role of SQSTM1 in different cellular processes.</p>

<p>Rabbit polyclonal PSA antibody (Prediluted for IHC)</p>

<p>Rabbit polyclonal SLC27A5 antibody</p>

<p>1-192 amino acids: MGSSHHHHHH SSGLVPRGSH MQAIKCVVVG DGAVGKTCLL ISYTTNAFPG EYIPTVFDNY SANVMVDGKP VNLGLWDTAG QEDYDRLRPL SYPQTDVFLI CFSLVSPASF ENVRAKWYPE VRHHCPNTPI ILVGTKLDLR DDKDTIEKLK EKKLTPITYP QGLAMAKEIG AVKYLECSAL TQRGLKTVFD EAIRAVLCPP PVKKRKRKCL LL</p>

<p>Mouse monoclonal MGLL antibody</p>

<p>Gambogenic acid is a naturally occurring compound, which is a diterpenoid extracted from the resin of the Garcinia hanburyi tree. The source of this product is primarily in Southeast Asia, where the plant species is native. Gambogenic acid acts by modulating intracellular signaling pathways, leading to the induction of apoptosis and the inhibition of proliferation in cancer cells. It primarily targets pathways such as the NF-κB and PI3K/Akt, which are crucial for cell survival and growth, thereby exhibiting its antiproliferative effects.</p>

<p>This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.</p>

<p>Wnt10A antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>The RUNX1 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the circumsporozoite protein, which plays a crucial role in the development of malaria parasites. This antibody is widely used for various applications, including immunohistochemistry, western blotting, and flow cytometry.</p>

<p>Fumarase antibody is a highly specific monoclonal antibody used in Life Sciences research. It targets fumarase, an enzyme involved in the Krebs cycle, and plays a crucial role in cellular energy production. This antibody has been extensively used to study various biological processes, including collagen synthesis, alpha-fetoprotein expression, and urokinase plasminogen activator activity. Additionally, it has proven valuable in investigating the role of fumarase in cell signaling pathways and growth factor regulation. The fumarase antibody is widely recognized for its high affinity and specificity, making it an essential tool for researchers working in diverse fields such as cell biology, immunology, and cancer research. With its ability to detect fumarase at a molecular level, this monoclonal antibody opens up new avenues for understanding complex biological mechanisms and developing novel therapeutic strategies.</p>

<p>Rabbit polyclonal PUS1 antibody</p>

<p>Rabbit polyclonal KCND2 antibody</p>

<p>Mouse monoclonal NGAL antibody (Biotin)</p>

<p>BAI1 antibody was raised in rabbit using a synthetic peptide conjugated to KLHd as the immunogen.</p>

<p>IL11R alpha antibody was raised using the N terminal of IL11RA corresponding to a region with amino acids QLGYPPARPVVSCQAADYENFSCTWSPSQISGLPTRYLTSYRKKTVLGAD</p>

<p>OVA conjugated Melatonin Hapten</p>

<p>1-285 amino acids: MGSSHHHHHH SSGLVPRGSH MSDIEEVVEE YEEEEQEEAA VEEQEEAAEE DAEAEAETEE TRAEEDEEEE EAKEAEDGPM EESKPKPRSF MPNLVPPKIP DGERVDFDDI HRKRMEKDLN ELQALIEAHF ENRKKEEEEL VSLKDRIERR RAERAEQQRI RNEREKERQN RLAEERARRE EEENRRKAED EARKKKALSN MMHFGGYIQK TERKSGKRQT EREKKKKILA ERRKVLAIDH LNEDQLREKA KELWQSIYNL EAEKFDLQEK FKQQKYEINV LRNRINDNQK VSKTRGKAKV TGRWK</p>

<p>BAG4 antibody was raised in Rabbit using Human BAG4 as the immunogen</p>

<p>Rabbit polyclonal VPS54 antibody</p>

<p>This antibody reacts with heavy chains on Donkey IgG and light chains on all Donkey immunoglobulins.</p>

<p>Rabbit polyclonal TUBB3 antibody (FITC)</p>

<p>Rabbit Polyclonal GSTT1/4 antibody</p>

<p>OVCA2 Antibody</p>

<p>RPS13 antibody was raised using the N terminal of RPS13 corresponding to a region with amino acids MGRMHAPGKGLSQSALPYRRSVPTWLKLTSDDVKEQIYKLAKKGLTPSQI</p>

<p>ZNF322A antibody was raised in rabbit using the N terminal of ZNF322A as the immunogen</p>

<p>KIAA1754L antibody was raised using the C terminal of KIAA1754L corresponding to a region with amino acids IPIPKTFRNAEPVNLFQHLVLNPKAHSQAVEEFQNLLTQVKTLPHAPLAA</p>

<p>Purified Polyclonal Cytochrome P450 8B1 antibody</p>

<p>CDC4 (69kDa) antibody was raised in rabbit using N terminus of the 69 kDa isoform of the hCdc4 protein as the immunogen.</p>

<p>Rabbit polyclonal PLEKHG6 antibody</p>

<p>HECTD2 antibody was raised using the N terminal of HECTD2 corresponding to a region with amino acids MSEAVRVPSPATPLVVAAPAPEERKGKESEREKLPPIVSAGAGATAGLDR</p>

<p>Mouse monoclonal MPP5 antibody</p>

<p>PRMT6 antibody was raised in Mouse using a purified recombinant fragment of human PRMT6 expressed in E. coli as the immunogen.</p>

<p>IL11 antibody was raised in Mouse using recombinant human IL-11 as the immunogen.</p>

<p>EARS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TAKHLLLYQALGWQPPHFAHLPLLLNRDGSKLSKRQGDVFLEHFAADGFL</p>

<p>REEP4 antibody was raised using the N terminal of REEP4 corresponding to a region with amino acids EIKMAFVLWLLSPYTKGASLLYRKFVHPSLSRHEKEIDAYIVQAKERSYE</p>

<p>Rabbit polyclonal TBPL1 antibody</p>

<p>ITLN1 antibody was raised in Rabbit using Human ITLN1 as the immunogen</p>

<p>The Hepatitis C Virus protein is a versatile and crucial component in the field of Life Sciences. It plays a significant role in various biological processes, including cell growth, differentiation, and immune response. This protein has been extensively studied for its interactions with other molecules and its impact on human health.</p>

<p>Rat RBC antibody was raised in rabbit using rat erythrocytes as the immunogen.</p>

<p>RPESP antibody was raised using the C terminal of RPESP corresponding to a region with amino acids WMQYLREGYTVCVDCQPPAMNSVSLRCSGDGLDSDGNQTLHWQAIGNPRC</p>

<p>GIMAP2 antibody was raised in Rabbit using Human GIMAP2 as the immunogen</p>

<p>GLS antibody was raised in Rabbit using Human GLS as the immunogen</p>

<p>Mouse monoclonal NXNL2 antibody</p>

<p>The AID antibody is a monoclonal antibody that has neutralizing properties and specifically targets the HER2 receptor. This antibody binds to the amino group of the HER2 growth factor and inhibits its activity. It can be used in various applications, such as immunohistochemistry, western blotting, and ELISA assays. The AID antibody has been extensively studied in the field of life sciences and has shown promising results in inhibiting tumor growth. It can also be used in combination with other antibodies, such as trastuzumab, to enhance its therapeutic effects. Additionally, this antibody has been shown to have interferon-like activity and can modulate gene expression in nuclear extracts. With its lysine-specific binding capabilities, the AID antibody offers researchers a valuable tool for studying epidermal growth factor signaling pathways and understanding their role in various cellular processes.</p>

<p>Rabbit polyclonal RPL19 antibody</p>

<p>Purified Polyclonal Cotinine 3 Antibody</p>

<p>NET antibody was raised in rabbit using a 22 amino acid peptide of rat NET as the immunogen.</p>

<p>The HOXB4 antibody is a highly specialized monoclonal antibody that acts as an inhibitor of the HOXB4 protein. This protein plays a crucial role in the regulation of hematopoietic stem cell proliferation and differentiation. By targeting and neutralizing the HOXB4 protein, this antibody effectively inhibits its cytotoxic effects and prevents the activation of downstream signaling pathways.</p>

<p>The SOCS3 antibody is a glycoprotein that belongs to the family of antibodies. It is specifically designed to target and bind to a specific antigen, which can be used for various applications in the Life Sciences field. The SOCS3 antibody is a monoclonal antibody, meaning it is produced by a single type of immune cell and has high specificity for its target antigen.</p>

<p>Mouse monoclonal GAS7 antibody</p>

<p>ABHD12 antibody was raised using the middle region of ABHD12 corresponding to a region with amino acids CPLLILHAEDDPVVPFQLGRKLYSIAAPARSFRDFKVQFVPFHSDLGYRH</p>

<p>Rabbit polyclonal RERG antibody</p>

<p>KN-92 is a potassium channel opener that has been shown to increase intracellular calcium levels in cardiac and neuronal cells. It also increases the energy metabolism of cardiac cells by increasing the mitochondrial membrane potential, leading to increased production of ATP. KN-92 has been shown to be effective in experimental models for structural heart disease. It also reduces the incidence of atrial arrhythmia and congestive heart failure in rats with experimentally induced myocardial infarction. KN-92 is not active against granule neurons.</p>

<p>Rabbit polyclonal WIPI2 antibody</p>

<p>LRRC33 antibody was raised using the N terminal of LRRC33 corresponding to a region with amino acids GLERLRELDLQRNYIFEIEGGAFDGLAELRHLNLAFNNLPCIVDFGLTRL</p>

<p>SLC25A24 antibody was raised using a synthetic peptide corresponding to a region with amino acids FLFNPVTDIEEIIRFWKHSTGIDIGDSLTIPDEFTEDEKKSGQWWRQLLA</p>

<p>Rabbit polyclonal ALK antibody (Tyr1507)</p>

<p>SUPT16H antibody was raised in rabbit using the N terminal of SUPT16H as the immunogen</p>

<p>Purified Polyclonal ATP8 antibody</p>

<p>Mouse monoclonal KRT18 antibody</p>

<p>Rabbit polyclonal SH3BP1 antibody</p>

<p>The GUF1 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It specifically targets and binds to the apical membrane of cells, allowing for precise detection and analysis. This antibody recognizes and interacts with specific tyrosine residues on growth factor receptors, providing valuable insights into signaling pathways and cellular responses.</p>

<p>AXUD1 antibody was raised in rabbit using human AXUD1 protein as the immunogen.</p>

<p>Mouse monoclonal OTUB2 antibody</p>

<p>Mouse monoclonal DLD antibody</p>

<p>The Caspase 9 antibody is a highly specialized polyclonal antibody that targets the caspase 9 enzyme involved in apoptosis. It plays a crucial role in regulating cell death and is essential for maintaining tissue homeostasis. This antibody has been extensively studied in the field of life sciences and has shown promising results in various research areas.</p>

<p>Rabbit polyclonal UPF3A antibody</p>

<p>The REN antibody is a highly specialized monoclonal antibody that targets the hepatocyte growth factor and chemokine receptor CXCR4. It acts as a potent family kinase inhibitor, blocking the signaling pathways involved in cell growth and migration. This colloidal antibody has been extensively studied in the field of life sciences and has shown promising results in inhibiting tumor growth and metastasis. Additionally, it has been found to have nephrotoxic effects, making it a potential therapeutic option for kidney-related disorders. The REN antibody is also used in research settings to detect autoantibodies and cytotoxic antibodies, as well as for studying thrombocytopenia. With its diverse applications and high efficacy, this antibody is an invaluable tool for scientists and researchers in various fields of study.</p>

<p>Mouse monoclonal BEST3 antibody</p>

<p>Rabbit polyclonal HMMR antibody</p>

<p>The PDLIM2 antibody is a highly specific monoclonal antibody that is used in various life science assays. It is designed to detect and bind to the PDLIM2 protein, which plays a crucial role in regulating cell proliferation, differentiation, and apoptosis. This antibody has been extensively validated for its high affinity and specificity, making it an ideal tool for researchers studying the function of PDLIM2 in different biological systems.</p>

<p>HSPA1A antibody was raised in Rabbit using Human HSPA1A as the immunogen</p>

<p>Rabbit polyclonal UGT8 antibody</p>

<p>NPFF2 antibody was raised in rabbit using N terminal sequence MNEKWDTNSSENWHPI and C terminal sequence ELVMEELKETTNSSEI of the human NPFF2 protein as the immunogen.</p>

<p>Mouse monoclonal PACSIN3 antibody</p>

<p>Armenian Hamster monoclonal CD61 antibody (FITC)</p>

<p>KLK11 antibody was raised in rabbit using residues 68-82 [YIVHLGQHNLQKEEG] of the 35 kDa human hippostasin/KLK11protein as the immunogen.</p>