Bioquímicos e reagentes

<p>Rabbit polyclonal UPF3A antibody</p>

<p>The REN antibody is a highly specialized monoclonal antibody that targets the hepatocyte growth factor and chemokine receptor CXCR4. It acts as a potent family kinase inhibitor, blocking the signaling pathways involved in cell growth and migration. This colloidal antibody has been extensively studied in the field of life sciences and has shown promising results in inhibiting tumor growth and metastasis. Additionally, it has been found to have nephrotoxic effects, making it a potential therapeutic option for kidney-related disorders. The REN antibody is also used in research settings to detect autoantibodies and cytotoxic antibodies, as well as for studying thrombocytopenia. With its diverse applications and high efficacy, this antibody is an invaluable tool for scientists and researchers in various fields of study.</p>

<p>Mouse monoclonal BEST3 antibody</p>

<p>Rabbit polyclonal HMMR antibody</p>

<p>The PDLIM2 antibody is a highly specific monoclonal antibody that is used in various life science assays. It is designed to detect and bind to the PDLIM2 protein, which plays a crucial role in regulating cell proliferation, differentiation, and apoptosis. This antibody has been extensively validated for its high affinity and specificity, making it an ideal tool for researchers studying the function of PDLIM2 in different biological systems.</p>

<p>HSPA1A antibody was raised in Rabbit using Human HSPA1A as the immunogen</p>

<p>Rabbit polyclonal UGT8 antibody</p>

<p>NPFF2 antibody was raised in rabbit using N terminal sequence MNEKWDTNSSENWHPI and C terminal sequence ELVMEELKETTNSSEI of the human NPFF2 protein as the immunogen.</p>

<p>Mouse monoclonal PACSIN3 antibody</p>

<p>Armenian Hamster monoclonal CD61 antibody (FITC)</p>

<p>KLK11 antibody was raised in rabbit using residues 68-82 [YIVHLGQHNLQKEEG] of the 35 kDa human hippostasin/KLK11protein as the immunogen.</p>

<p>ZMYND11 antibody was raised in rabbit using the N terminal of ZMYND11 as the immunogen</p>

<p>1-207 amino acids: MGSSHHHHHH SSGLVPRGSH MDKDCEMKRT TLDSPLGKLE LSGCEQGLHE IKLLGKGTSA ADAVEVPAPA AVLGGPEPLM QCTAWLNAYF HQPEAIEEFP VPAFHHPVFQ QESFTRQVLW KLLKVVKFGE VISYQQLAAL AGNPKAARAV GGAMRGNPVP ILIPCHRVVC SSGAVGNYSG GLAVKEWLLA HEGHRLGKPG LGGSSGLAGA WLKGAGATSG SPPAGRN</p>

<p>Hexokinase antibody was raised in mouse using recombinant human Hexokinase1 (1-917aa) purified from E. coli as the immunogen.</p>

<p>Digitoxin antibody was raised in rabbit using digitoxin-BSA as the immunogen.</p>

<p>ERK1 antibody was raised in mouse using recombinant full length ERK1 protein as the immunogen.</p>

<p>Rabbit polyclonal KRBP antibody</p>

<p>Matrilin 3 antibody was raised using the middle region of MATN3 corresponding to a region with amino acids IELYAVGVDRADMASLKMMASEPLEEHVFYVETYGVIEKLSSRFQETFCA</p>

<p>The SIGLEC9 antibody is a monoclonal antibody that is used in immunoassays to detect autoantibodies in human serum. It can be immobilized on an electrode and used for the quantitation of specific markers or proteins. This antibody has anti-angiogenesis properties, making it valuable in research and potential treatment and/or prophylaxis of angiogenesis-related conditions. The SIGLEC9 antibody can be used in combination with streptavidin or other detection methods to enhance sensitivity and specificity in various life science applications. Its high affinity for histidine makes it an excellent tool for protein purification and analysis.</p>

<p>1-162 amino acids: MGSSHHHHHH SSGLVPRGSH MPRADCIMRH LPYFCRGQVV RGFGRGSKQL GIPTANFPEQ VVDNLPADIS TGIYYGWASV GSGDVHKMVV SIGWNPYYKN TKKSMETHIM HTFKEDFYGE ILNVAIVGYL RPEKNFDSLE SLISAIQGDI EEAKKRLELP EHLKIKEDNF FQVSKSKIMN GH</p>

<p>RBM22 antibody was raised using the C terminal of RBM22 corresponding to a region with amino acids KWGRSQAARGKEKEKDGTTDSGIKLEPVPGLPGALPPPPAAEEEASANYF</p>

<p>LYZ antibody was raised in Rabbit using Human LYZ as the immunogen</p>

<p>Rabbit polyclonal Ret antibody (Tyr1062)</p>

<p>CDH22 antibody was raised using the N terminal of CDH22 corresponding to a region with amino acids LIDELTGDIHAMERLDREQKTFYTLRAQARDRATNRLLEPESEFIIKVQD</p>

<p>Rat monoclonal CD4 antibody (allophycocyanin); IgG2b kappa; clone GK1.5</p>

<p>The TrkA antibody is a highly specialized protein complex that plays a crucial role in various Life Sciences research applications. It is commonly used as a tool for studying the functions and interactions of specific proteins, such as c-myc and alpha-fetoprotein. This antibody is widely recognized for its exceptional specificity and sensitivity, making it an ideal choice for researchers in the field.</p>

<p>STEAP4 antibody was raised using the C terminal of STEAP4 corresponding to a region with amino acids AFLHVLYTLVIPIRYYVRWRLGNLTVTQAILKKENPFSTSSAWLSDSYVA</p>

<p>TUFM antibody was raised using the middle region of TUFM corresponding to a region with amino acids PEKELAMPGEDLKFNLILRQPMILEKGQRFTLRDGNRTIGTGLVTNTLAM</p>

<p>Rabbit polyclonal HNRPH1 antibody (biotin)</p>

<p>Eotaxin 2 antibody was raised in goat using highly pure recombinant murine eotaxin-2 as the immunogen.</p>

<p>MAP3K10 antibody was raised in Rabbit using Human MAP3K10 as the immunogen</p>

<p>Mouse monoclonal ATG3 antibody</p>

<p>JARID2 antibody was raised using the N terminal of JARID2 corresponding to a region with amino acids THKHVHNGHVFNGSSRSTREKEPVQKHKSKEATPAKEKHSDHRADSRREQ</p>

<p>NMT1 antibody was raised using the N terminal of NMT1 corresponding to a region with amino acids TMEEASKRSYQFWDTQPVPKLGEVVNTHGPVEPDKDNIRQEPYTLPQGFT</p>

<p>Rabbit polyclonal Spa17 antibody (FITC)</p>

<p>Rabbit polyclonal TRKA antibody (Tyr791)</p>

<p>1-223 amino acids: MRGSHHHHHH GMASMTGGQQ MGRDLYDDDD KDRWGSMASK LLRAVILGPP GSGKGTVSQR IAQNFGLQHL SSGHFLRENI KASTEVGEMA KQYIEKSLLV PDHVITRLMM SELENRRGQH WLLDGFPRTL GQAEALDKIC EVDLVISLNI PFETLKDRLS RRWIHPPSGR VYNLDFNPPH VHGIDDVTGE PLVQQEDDKP EAVAARLRQY KDVAKPVIEL YKSRGVLHQF SGTETNKIWP YVYTLFSNKI TPIQSKEAY</p>

<p>The AML1 antibody is a growth factor monoclonal antibody that is used in Life Sciences research. It specifically targets AML1, a transcription factor involved in hematopoiesis and leukemogenesis. This antibody can be used to study the role of AML1 in various cellular processes, such as cell proliferation, differentiation, and apoptosis. The AML1 antibody is produced using advanced techniques that ensure high specificity and affinity for its target. It can be used in a variety of applications, including Western blotting, immunofluorescence, and immunohistochemistry. With its ability to bind to AML1 and inhibit its function, this antibody provides valuable insights into the mechanisms underlying leukemia development and progression. Researchers and scientists rely on the AML1 antibody to advance their understanding of hematopoiesis and develop potential therapeutic strategies for leukemia treatment.</p>

<p>Sideroflexin 3 antibody was raised using the middle region of SFXN3 corresponding to a region with amino acids TPITVRQLGTAYVSATTGAVATALGLKSLTKHLPPLVGRFVPFAAVAAAN</p>

<p>Tolfenamic Acid Conjugate for use in immunoassays</p>

<p>CDC27 antibody is a high-quality polyclonal antibody that specifically targets CDC27 protein. This antibody can be used in various research applications, including immunohistochemistry, western blotting, and ELISA. CDC27 is an essential component of the anaphase-promoting complex/cyclosome (APC/C), which plays a crucial role in cell cycle regulation. It is involved in the degradation of cell cycle regulators and ensures the proper progression through mitosis. The CDC27 antibody has been validated for its specificity and sensitivity, making it a reliable tool for studying cell cycle dynamics and understanding the mechanisms underlying cell division. With its outstanding performance and versatility, this antibody is a valuable asset for researchers in the field of life sciences.</p>

<p>Mouse monoclonal PTPN7 antibody</p>

<p>Sheep polyclonal Tacrolimus 22 antibody</p>

<p>The C1S antibody is a monoclonal antibody that targets the cholinergic growth factor. It is designed to specifically bind to and neutralize the activity of C1S, a protease involved in various biological processes. This antibody has been shown to induce cell lysis and inhibit the activity of C1S in human serum. Additionally, it has anti-idiotypic properties, meaning it can bind to and block the binding of other antibodies to their target molecules. The C1S antibody is widely used in life sciences research for its ability to study protease activity and glycopeptide metabolism. Its low pH stability makes it suitable for various applications requiring acidic conditions. With its high specificity and neutralizing capabilities, this monoclonal antibody is an invaluable tool for studying C1S-related processes in both basic research and therapeutic development.</p>

<p>ZNF499 antibody was raised in rabbit using the middle region of ZNF499 as the immunogen</p>

<p>SDF1 alpha antibody was raised in rabbit using highly pure recombinant human SDF-1-alpha as the immunogen.</p>

<p>The STS antibody is a highly specialized antibody used in the field of Life Sciences. It is commonly used in research and diagnostic applications. This antibody is designed to specifically target and bind to STS (steroid sulfatase), an enzyme involved in the metabolism of steroid hormones. The STS antibody can be used for various techniques, including polymerase chain reaction (PCR), lectin binding assays, carbonic anhydrase activity assays, and hybridization studies.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FBXO31 antibody, catalog no. 70R-2500</p>

<p>FAM14A antibody was raised using the middle region of FAM14A corresponding to a region with amino acids LSTSSNILLASVGSVLGACLGNSPSSSLPAEPEAKEDEARENVPQGEPPK</p>

<p>Rat monoclonal CD19 antibody (biotin)</p>

<p>PF9601N is a selective inhibitor of the enzyme dopamine-beta-hydroxylase (DBH). DBH is a rate-limiting enzyme in the synthesis of dopamine, and PF9601N has been shown to provide neuroprotection against neuronal death. PF9601N binds reversibly to the active site of DBH and inhibits amine oxidation, thereby inhibiting the production of norepinephrine and epinephrine. The basic structure of PF9601N is similar to that of reserpine, which was used for decades as an antihypertensive drug. The in vivo model for PF9601N is rat striatal cells treated with 6-hydroxydopamine, which induces cell death by apoptosis. In response to this treatment, cells treated with PF9601N showed significantly less neuronal death than those not treated with the compound.</p>

<p>The TUBB3 antibody is a monoclonal antibody used in the field of Life Sciences. It specifically targets the tubulin beta-3 chain, which is involved in cell division and growth. This antibody has been extensively studied for its role in various cellular processes, including the regulation of alpha-fetoprotein and dopamine levels, as well as the modulation of growth factors.</p>

<p>The SHMT2 antibody is a highly specialized monoclonal antibody that targets the serine hydroxymethyltransferase 2 (SHMT2) protein. This protein plays a crucial role in the metabolism of fatty acids and acts as a growth factor in various cellular processes. The SHMT2 antibody specifically binds to the SHMT2 protein, allowing for its detection and analysis in research and diagnostic applications.</p>

<p>LRRTM1 antibody was raised using the middle region of LRRTM1 corresponding to a region with amino acids RIFQDCRSLKFLDIGYNQLKSLARNSFAGLFKLTELHLEHNDLVKVNFAH</p>

<p>Rabbit polyclonal TNNI1 antibody</p>

<p>TYMS antibody was raised in mouse using recombinant TYMS (1-313aa) purified from E. coli as the immunogen.</p>

<p>Mouse monoclonal UBXN2B antibody</p>

<p>ACVR1C antibody was raised using the N terminal of ACVR1C corresponding to a region with amino acids QVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPMELAIIITVP</p>

<p>Rabbit anti-canine IgG (H + L) (HRP) was raised in rabbit using canine IgG (H &amp; L) as the immunogen.</p>

<p>UBA5 antibody was raised using the middle region of UBA5 corresponding to a region with amino acids VLSCVDNFEARMTINTACNELGQTWMESGVSENAVSGHIQLIIPGESACF</p>

<p>Fosgemcitabine is a peptide analog that binds to the active site of the DNA ligase, an enzyme involved in DNA repair. Fosgemcitabine has been shown to inhibit the enzymatic activity of DNA ligase and lead to cell death by inhibiting protein synthesis and cell division. Fosgemcitabine is also known as palabenamide, which is a synthetic compound that acts as a selective inhibitor of the ion channel TRPM2. The binding of palabenamide to TRPM2 leads to inhibition of calcium influx into cells and subsequent cell death. Palabenamide has been shown to inhibit the proliferation of human T-cells and suppress antigen-specific immune responses in mice models.</p>

<p>Ac710 mesylate is a small molecule that is being developed for the treatment of fibrosis. It blocks the activity of collagen-specific TGF-β1 and TGF-β3, which are cytokines that function as signaling molecules in fibrosis. Ac710 mesylate has been shown to inhibit alveolar type II cell proliferation and induce lung fibrosis in mice. The drug was also shown to prevent emphysema development in rats with chronic bronchitis, by reducing protein expression and neutrophil infiltration.</p>

<p>KCNJ13 antibody was raised in Rabbit using Human KCNJ13 as the immunogen</p>

<p>The Myc antibody is a monoclonal antibody that specifically targets the c-Myc protein. It has a high affinity for c-Myc, which is a nuclear biomolecule involved in the regulation of cell growth and proliferation. The Myc antibody can be used in various life sciences research applications to study the role of c-Myc in different cellular processes.</p>

<p>Purified recombinant OCIAD2 protein (His tag)</p>

<p>LRRC26 antibody was raised using the middle region of Lrrc26 corresponding to a region with amino acids LRPLCAWLRRHPLPASEAETVLCVWPGRLTLSPLTAFSDAAFSHCAQPLA</p>

<p>OVA conjugated Sulfamethoxydiazine Hapten</p>

<p>Rabbit polyclonal ITGB6 antibody</p>

<p>Indanazoline is a molecule that is an analog of indole. It has been used in the treatment of inflammatory bowel disease, although its mechanism of action is not yet known. Indanazoline has been shown to inhibit the growth of bacteria and fungi, as well as being effective in animal experiments for treating bowel disease. This drug also has a number of side effects, including diarrhea and abdominal pain. In addition, indanazoline may cause population growth in animals if given in high doses.</p>

<p>HJC0152 Hydrochloride is a research compound that acts as a selective agonist of the sphingosine-1-phosphate receptor 5 (S1P5). This compound originates from synthetic chemical sources, where it is meticulously crafted to interact specifically with the S1P5 receptor. Through binding to this receptor, HJC0152 Hydrochloride modulates signaling pathways involved in cellular processes, particularly within the central nervous system.</p>

<p>BAY 2416964 is a chemical compound that is used as an antioxidant in skin care products. It has been shown to have synergistic effects when applied with other antioxidants, such as vitamin E or green tea extract. This compound is used to prevent dehydration and improve the appearance of dry skin. BAY 2416964 also has antioxidant effects, which may help protect against oxidative damage caused by free radicals and reactive oxygen species in the environment. The use of this drug has been reported to help with symptoms of skin conditions such as dermatitis, psoriasis, and eczema. BAY 2416964 has been shown to inhibit the growth of prostate cancer cells "in vitro" by disrupting the cell cycle.</p>

<p>Methyltetrazine agarose is a 6% crosslinked agarose resin that is activated with methyltetrazine functional groups for covalent immobilization of TCO-modified biomolecules via a Diels–Alder  reaction. Applications are preparation of protein agarose media with almost quantitative capture of proteins.<br>Activation level: 10-20 µmol methyltetrazine groups per mL resin<br>Bead size: 50-150 µm</p>

<p>NKH 477 is a drug that has been shown to increase the amount of calcium in the cytosol of cells. It has been found to be effective at low doses, which may be due to its ability to activate phospholipase C and stimulate the release of calcium from intracellular stores. NKH477 is an analogue of glucagon-like peptide 1 (GLP-1) and has been shown to have similar effects on cardiac muscle, but with less effect on pancreatic beta cells.<br>The effect of NKH 477 on cardiac muscle was studied in vitro using papillary muscle strips from guinea pig hearts. The drug was shown to cause relaxation of the muscles by stimulating ryanodine receptors, which are responsible for releasing calcium from intracellular stores. This drug may also have potential as a treatment for type 2 diabetes mellitus by activating GLP-1 receptors in the pancreas.</p>

<p>Portion of EBV</p>

<p>Direct inhibitor of thrombin</p>

<p>E-7766 is a potent anticancer drug that is derived from urine and has been used in medicinal practices for its kinase inhibitory properties. It is an analog of indirubin, a natural compound found in Chinese herbal medicine. E-7766 induces apoptosis in cancer cells by targeting specific protein kinases, which are essential for cell survival and proliferation. This drug has shown promising results in preclinical studies as an inhibitor of various types of cancer, including breast, lung, and prostate cancer. E-7766 has the potential to be a highly effective therapy for the treatment of multiple cancers due to its ability to selectively target cancer cells while sparing healthy cells. Its unique mechanism of action makes it a valuable addition to the arsenal of anticancer drugs available today.</p>

<p>TAK-448 acetate is a synthetic GnRH receptor antagonist, which is derived from advanced peptide engineering. Its mechanism of action involves competitive inhibition of the gonadotropin-releasing hormone receptors in the pituitary gland, subsequently leading to the suppression of luteinizing hormone and follicle-stimulating hormone release. This suppression effectively reduces the downstream production of sex steroids, such as testosterone and estradiol.</p>

<p>Please enquire for more information about N-((1-Benzyl-1H-indol-3-yl)methyl)pyridin-3-amine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Z)-16-(Ethylcarbamoylamino)hexadec-11-enoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ko-3290 is an α/β-adrenergic receptor agonist that can be used as a bronchodilator in the treatment of asthma. Ko-3290 has been shown to decrease blood pressure and increase cardiac output in supine dogs. In addition, it has been shown to stimulate lipolysis and inhibit insulin release. This drug also has the potential to differentiate between species, which is important for the treatment of human patients. The effects of Ko-3290 on metabolic parameters (e.g., serum insulin, fatty acids) are not always consistent across different species, so it is important to monitor these levels when administering this drug to humans.</p>

<p>BMS 345541 is a selective inhibitor of IKK-β, which is an enzyme involved in the nuclear factor kappa-light-chain-enhancer of activated B cells (NF-κB) signaling pathway. It is synthesized through chemical synthesis, which allows for its precise targeting and modulation of specific signaling cascades.</p>

<p>Please enquire for more information about Alverine-d5 citrate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>The Rac1 inhibitor F56 is a research tool that can be used to study the activation, ligand binding, and receptor-mediated signaling of Rac1. It is a potent inhibitor that inhibits the activity of Rac1 in cells. The Rac1 Inhibitor F56 is a high purity, water soluble peptide with an average MW of 527 Da. It has been shown to inhibit ion channels and protein synthesis in cell cultures.</p>

<p>d9-Triacetylnormorphine is a potent activator of opioid receptors and an inhibitor of ion channels. It can be used as a research tool in the study of pharmacology, protein interactions, receptor peptides, ligand binding, and ion channel physiology. d9-Triacetylnormorphine binds to the mu opioid receptor with high affinity and acts as an antagonist at the kappa opioid receptor. This drug also inhibits voltage-gated potassium channels (VGPCs) by binding to their extracellular domain. d9-Triacetylnormorphine has been shown to inhibit VGPCs by stabilizing the open state of VGPCs.</p>

<p>Inhibitor of checkpoint kinase CHK1</p>

<p>Ag-09/1 is a peptide that interacts with the antibody and receptor. Ag-09/1 is a high purity and research tool for studying protein interactions. It is an inhibitor of ion channels, which are important in the transmission of electrical signals across nerve cells. Ag-09/1 also has pharmacological activity as an activator of receptor. This ligand binds to the receptor and increases its activity, which can lead to an increase in the production of neurotransmitters or hormones.</p>

<p>Myt1 is a human ion channel protein that belongs to the superfamily of ligand-gated ion channels. The protein is localized in the postsynaptic membrane and is activated by glutamate. Myt1 plays an important role in synaptic plasticity and memory formation, which are essential for learning and memory. Myt1 has also been shown to be involved in the regulation of neuronal excitability because it mediates calcium influx into neurons and regulates potassium efflux from neurons. Myt1 has been used as a research tool to investigate protein interactions, such as those with receptor proteins such as GluR2 or L-type calcium channels.<br>Myt1 can also be used as an antibody to study its function on other proteins, such as AMPA receptors, or to identify other proteins that interact with myt1.</p>

<p>The 1-morpholino-1-(thiophen-2-yl)propane-2-yl)-3-(2-(trifluoromethoxy)phenyl)thiourea (MTT) is a research tool, which is used as an activator, ligand, receptor or cell biology. It has been shown to inhibit ion channels and cause changes in the properties of protein interactions. The MTT has also been shown to be an inhibitor of peptides.</p>

<p>Linatine is a peptide with molecular weight of 699 Da. It inhibits the activation of protein kinase C and protein tyrosine phosphatase. Linatine can also activate protein kinase A, but not as much as for protein kinase C. This is due to its high affinity for the substrate site on protein kinase A. Linatine has been shown to be a good research tool for studying ion channels and receptors in cell biology studies.</p>

<p>M 1145 is a monoclonal antibody, which is derived from a highly specific and engineered immunoglobulin source. Its mode of action involves targeting and modulating specific immune cell receptors, disrupting signaling pathways that are critical for the activation and proliferation of these cells. As a result, it can effectively modulate immune responses, making it a promising candidate for therapeutic applications in autoimmune diseases and certain types of cancers.</p>

<p>Rabbit polyclonal ELOA2 antibody</p>

<p>PTCH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TILGVLNGLVLLPVLLSFFGPYPEVSPANGLNRLPTPSPEPPPSVVRFAM</p>

<p>Rat monoclonal CD244.2 antibody (FITC)</p>

<p>Purified recombinant EXOSC3 protein (His tag)</p>

<p>Az7550 hydrochloride is a research tool for the study of ion channels and receptor interactions. It is a ligand that binds to the peptide receptor site on the cell membrane and activates the channel, leading to an influx of ions into the cell. Az7550 hydrochloride has been shown to activate potassium channels by binding to their ligand-binding site.<br>Az7550 hydrochloride has also been used as an antibody labeling agent for immunofluorescence staining.</p>

<p>Rabbit polyclonal ZAP70 antibody (Tyr493)</p>

<p>PDK3 antibody was raised using the middle region of PDK3 corresponding to a region with amino acids IYLKALSSESFERLPVFNKSAWRHYKTTPEADDWSNPSSEPRDASKYKAK</p>

<p>LRRC24 antibody was raised using the N terminal of LRRC24 corresponding to a region with amino acids PLAALRRLYLHNNSLRALEAGAFRAQPRLLELALTSNRLRGLRSGAFVGL</p>

<p>IRS1 antibody was raised in Rabbit using Human IRS1 as the immunogen</p>

<p>KIAA0692 antibody was raised using the middle region of Kiaa0692 corresponding to a region with amino acids CYSPSDRQSWPSPAVKGRFKSQLPDLSGPHSYSPGRNSVAGSNPAKPGLG</p>