Bioquímicos e reagentes

<p>Rabbit polyclonal SH3BP1 antibody</p>

<p>The GUF1 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It specifically targets and binds to the apical membrane of cells, allowing for precise detection and analysis. This antibody recognizes and interacts with specific tyrosine residues on growth factor receptors, providing valuable insights into signaling pathways and cellular responses.</p>

<p>AXUD1 antibody was raised in rabbit using human AXUD1 protein as the immunogen.</p>

<p>Mouse monoclonal OTUB2 antibody</p>

<p>Mouse monoclonal DLD antibody</p>

<p>The Caspase 9 antibody is a highly specialized polyclonal antibody that targets the caspase 9 enzyme involved in apoptosis. It plays a crucial role in regulating cell death and is essential for maintaining tissue homeostasis. This antibody has been extensively studied in the field of life sciences and has shown promising results in various research areas.</p>

<p>Rabbit polyclonal UPF3A antibody</p>

<p>The REN antibody is a highly specialized monoclonal antibody that targets the hepatocyte growth factor and chemokine receptor CXCR4. It acts as a potent family kinase inhibitor, blocking the signaling pathways involved in cell growth and migration. This colloidal antibody has been extensively studied in the field of life sciences and has shown promising results in inhibiting tumor growth and metastasis. Additionally, it has been found to have nephrotoxic effects, making it a potential therapeutic option for kidney-related disorders. The REN antibody is also used in research settings to detect autoantibodies and cytotoxic antibodies, as well as for studying thrombocytopenia. With its diverse applications and high efficacy, this antibody is an invaluable tool for scientists and researchers in various fields of study.</p>

<p>Mouse monoclonal BEST3 antibody</p>

<p>Rabbit polyclonal HMMR antibody</p>

<p>The PDLIM2 antibody is a highly specific monoclonal antibody that is used in various life science assays. It is designed to detect and bind to the PDLIM2 protein, which plays a crucial role in regulating cell proliferation, differentiation, and apoptosis. This antibody has been extensively validated for its high affinity and specificity, making it an ideal tool for researchers studying the function of PDLIM2 in different biological systems.</p>

<p>HSPA1A antibody was raised in Rabbit using Human HSPA1A as the immunogen</p>

<p>Rabbit polyclonal UGT8 antibody</p>

<p>NPFF2 antibody was raised in rabbit using N terminal sequence MNEKWDTNSSENWHPI and C terminal sequence ELVMEELKETTNSSEI of the human NPFF2 protein as the immunogen.</p>

<p>Mouse monoclonal PACSIN3 antibody</p>

<p>Armenian Hamster monoclonal CD61 antibody (FITC)</p>

<p>KLK11 antibody was raised in rabbit using residues 68-82 [YIVHLGQHNLQKEEG] of the 35 kDa human hippostasin/KLK11protein as the immunogen.</p>

<p>ZMYND11 antibody was raised in rabbit using the N terminal of ZMYND11 as the immunogen</p>

<p>1-207 amino acids: MGSSHHHHHH SSGLVPRGSH MDKDCEMKRT TLDSPLGKLE LSGCEQGLHE IKLLGKGTSA ADAVEVPAPA AVLGGPEPLM QCTAWLNAYF HQPEAIEEFP VPAFHHPVFQ QESFTRQVLW KLLKVVKFGE VISYQQLAAL AGNPKAARAV GGAMRGNPVP ILIPCHRVVC SSGAVGNYSG GLAVKEWLLA HEGHRLGKPG LGGSSGLAGA WLKGAGATSG SPPAGRN</p>

<p>Hexokinase antibody was raised in mouse using recombinant human Hexokinase1 (1-917aa) purified from E. coli as the immunogen.</p>

<p>Digitoxin antibody was raised in rabbit using digitoxin-BSA as the immunogen.</p>

<p>ERK1 antibody was raised in mouse using recombinant full length ERK1 protein as the immunogen.</p>

<p>Rabbit polyclonal KRBP antibody</p>

<p>Matrilin 3 antibody was raised using the middle region of MATN3 corresponding to a region with amino acids IELYAVGVDRADMASLKMMASEPLEEHVFYVETYGVIEKLSSRFQETFCA</p>

<p>The SIGLEC9 antibody is a monoclonal antibody that is used in immunoassays to detect autoantibodies in human serum. It can be immobilized on an electrode and used for the quantitation of specific markers or proteins. This antibody has anti-angiogenesis properties, making it valuable in research and potential treatment and/or prophylaxis of angiogenesis-related conditions. The SIGLEC9 antibody can be used in combination with streptavidin or other detection methods to enhance sensitivity and specificity in various life science applications. Its high affinity for histidine makes it an excellent tool for protein purification and analysis.</p>

<p>1-162 amino acids: MGSSHHHHHH SSGLVPRGSH MPRADCIMRH LPYFCRGQVV RGFGRGSKQL GIPTANFPEQ VVDNLPADIS TGIYYGWASV GSGDVHKMVV SIGWNPYYKN TKKSMETHIM HTFKEDFYGE ILNVAIVGYL RPEKNFDSLE SLISAIQGDI EEAKKRLELP EHLKIKEDNF FQVSKSKIMN GH</p>

<p>RBM22 antibody was raised using the C terminal of RBM22 corresponding to a region with amino acids KWGRSQAARGKEKEKDGTTDSGIKLEPVPGLPGALPPPPAAEEEASANYF</p>

<p>LYZ antibody was raised in Rabbit using Human LYZ as the immunogen</p>

<p>Rabbit polyclonal Ret antibody (Tyr1062)</p>

<p>CDH22 antibody was raised using the N terminal of CDH22 corresponding to a region with amino acids LIDELTGDIHAMERLDREQKTFYTLRAQARDRATNRLLEPESEFIIKVQD</p>

<p>Rat monoclonal CD4 antibody (allophycocyanin); IgG2b kappa; clone GK1.5</p>

<p>The TrkA antibody is a highly specialized protein complex that plays a crucial role in various Life Sciences research applications. It is commonly used as a tool for studying the functions and interactions of specific proteins, such as c-myc and alpha-fetoprotein. This antibody is widely recognized for its exceptional specificity and sensitivity, making it an ideal choice for researchers in the field.</p>

<p>STEAP4 antibody was raised using the C terminal of STEAP4 corresponding to a region with amino acids AFLHVLYTLVIPIRYYVRWRLGNLTVTQAILKKENPFSTSSAWLSDSYVA</p>

<p>TUFM antibody was raised using the middle region of TUFM corresponding to a region with amino acids PEKELAMPGEDLKFNLILRQPMILEKGQRFTLRDGNRTIGTGLVTNTLAM</p>

<p>Rabbit polyclonal HNRPH1 antibody (biotin)</p>

<p>Eotaxin 2 antibody was raised in goat using highly pure recombinant murine eotaxin-2 as the immunogen.</p>

<p>MAP3K10 antibody was raised in Rabbit using Human MAP3K10 as the immunogen</p>

<p>Mouse monoclonal ATG3 antibody</p>

<p>JARID2 antibody was raised using the N terminal of JARID2 corresponding to a region with amino acids THKHVHNGHVFNGSSRSTREKEPVQKHKSKEATPAKEKHSDHRADSRREQ</p>

<p>NMT1 antibody was raised using the N terminal of NMT1 corresponding to a region with amino acids TMEEASKRSYQFWDTQPVPKLGEVVNTHGPVEPDKDNIRQEPYTLPQGFT</p>

<p>Rabbit polyclonal Spa17 antibody (FITC)</p>

<p>Rabbit polyclonal TRKA antibody (Tyr791)</p>

<p>1-223 amino acids: MRGSHHHHHH GMASMTGGQQ MGRDLYDDDD KDRWGSMASK LLRAVILGPP GSGKGTVSQR IAQNFGLQHL SSGHFLRENI KASTEVGEMA KQYIEKSLLV PDHVITRLMM SELENRRGQH WLLDGFPRTL GQAEALDKIC EVDLVISLNI PFETLKDRLS RRWIHPPSGR VYNLDFNPPH VHGIDDVTGE PLVQQEDDKP EAVAARLRQY KDVAKPVIEL YKSRGVLHQF SGTETNKIWP YVYTLFSNKI TPIQSKEAY</p>

<p>The AML1 antibody is a growth factor monoclonal antibody that is used in Life Sciences research. It specifically targets AML1, a transcription factor involved in hematopoiesis and leukemogenesis. This antibody can be used to study the role of AML1 in various cellular processes, such as cell proliferation, differentiation, and apoptosis. The AML1 antibody is produced using advanced techniques that ensure high specificity and affinity for its target. It can be used in a variety of applications, including Western blotting, immunofluorescence, and immunohistochemistry. With its ability to bind to AML1 and inhibit its function, this antibody provides valuable insights into the mechanisms underlying leukemia development and progression. Researchers and scientists rely on the AML1 antibody to advance their understanding of hematopoiesis and develop potential therapeutic strategies for leukemia treatment.</p>

<p>Sideroflexin 3 antibody was raised using the middle region of SFXN3 corresponding to a region with amino acids TPITVRQLGTAYVSATTGAVATALGLKSLTKHLPPLVGRFVPFAAVAAAN</p>

<p>Tolfenamic Acid Conjugate for use in immunoassays</p>

<p>CDC27 antibody is a high-quality polyclonal antibody that specifically targets CDC27 protein. This antibody can be used in various research applications, including immunohistochemistry, western blotting, and ELISA. CDC27 is an essential component of the anaphase-promoting complex/cyclosome (APC/C), which plays a crucial role in cell cycle regulation. It is involved in the degradation of cell cycle regulators and ensures the proper progression through mitosis. The CDC27 antibody has been validated for its specificity and sensitivity, making it a reliable tool for studying cell cycle dynamics and understanding the mechanisms underlying cell division. With its outstanding performance and versatility, this antibody is a valuable asset for researchers in the field of life sciences.</p>

<p>Mouse monoclonal PTPN7 antibody</p>

<p>Sheep polyclonal Tacrolimus 22 antibody</p>

<p>The C1S antibody is a monoclonal antibody that targets the cholinergic growth factor. It is designed to specifically bind to and neutralize the activity of C1S, a protease involved in various biological processes. This antibody has been shown to induce cell lysis and inhibit the activity of C1S in human serum. Additionally, it has anti-idiotypic properties, meaning it can bind to and block the binding of other antibodies to their target molecules. The C1S antibody is widely used in life sciences research for its ability to study protease activity and glycopeptide metabolism. Its low pH stability makes it suitable for various applications requiring acidic conditions. With its high specificity and neutralizing capabilities, this monoclonal antibody is an invaluable tool for studying C1S-related processes in both basic research and therapeutic development.</p>

<p>ZNF499 antibody was raised in rabbit using the middle region of ZNF499 as the immunogen</p>

<p>SDF1 alpha antibody was raised in rabbit using highly pure recombinant human SDF-1-alpha as the immunogen.</p>

<p>The STS antibody is a highly specialized antibody used in the field of Life Sciences. It is commonly used in research and diagnostic applications. This antibody is designed to specifically target and bind to STS (steroid sulfatase), an enzyme involved in the metabolism of steroid hormones. The STS antibody can be used for various techniques, including polymerase chain reaction (PCR), lectin binding assays, carbonic anhydrase activity assays, and hybridization studies.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FBXO31 antibody, catalog no. 70R-2500</p>

<p>FAM14A antibody was raised using the middle region of FAM14A corresponding to a region with amino acids LSTSSNILLASVGSVLGACLGNSPSSSLPAEPEAKEDEARENVPQGEPPK</p>

<p>Rat monoclonal CD19 antibody (biotin)</p>

<p>PF9601N is a selective inhibitor of the enzyme dopamine-beta-hydroxylase (DBH). DBH is a rate-limiting enzyme in the synthesis of dopamine, and PF9601N has been shown to provide neuroprotection against neuronal death. PF9601N binds reversibly to the active site of DBH and inhibits amine oxidation, thereby inhibiting the production of norepinephrine and epinephrine. The basic structure of PF9601N is similar to that of reserpine, which was used for decades as an antihypertensive drug. The in vivo model for PF9601N is rat striatal cells treated with 6-hydroxydopamine, which induces cell death by apoptosis. In response to this treatment, cells treated with PF9601N showed significantly less neuronal death than those not treated with the compound.</p>

<p>The TUBB3 antibody is a monoclonal antibody used in the field of Life Sciences. It specifically targets the tubulin beta-3 chain, which is involved in cell division and growth. This antibody has been extensively studied for its role in various cellular processes, including the regulation of alpha-fetoprotein and dopamine levels, as well as the modulation of growth factors.</p>

<p>The SHMT2 antibody is a highly specialized monoclonal antibody that targets the serine hydroxymethyltransferase 2 (SHMT2) protein. This protein plays a crucial role in the metabolism of fatty acids and acts as a growth factor in various cellular processes. The SHMT2 antibody specifically binds to the SHMT2 protein, allowing for its detection and analysis in research and diagnostic applications.</p>

<p>LRRTM1 antibody was raised using the middle region of LRRTM1 corresponding to a region with amino acids RIFQDCRSLKFLDIGYNQLKSLARNSFAGLFKLTELHLEHNDLVKVNFAH</p>

<p>Rabbit polyclonal TNNI1 antibody</p>

<p>TYMS antibody was raised in mouse using recombinant TYMS (1-313aa) purified from E. coli as the immunogen.</p>

<p>Mouse monoclonal UBXN2B antibody</p>

<p>ACVR1C antibody was raised using the N terminal of ACVR1C corresponding to a region with amino acids QVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPMELAIIITVP</p>

<p>Rabbit anti-canine IgG (H + L) (HRP) was raised in rabbit using canine IgG (H &amp; L) as the immunogen.</p>

<p>UBA5 antibody was raised using the middle region of UBA5 corresponding to a region with amino acids VLSCVDNFEARMTINTACNELGQTWMESGVSENAVSGHIQLIIPGESACF</p>

<p>Fosgemcitabine is a peptide analog that binds to the active site of the DNA ligase, an enzyme involved in DNA repair. Fosgemcitabine has been shown to inhibit the enzymatic activity of DNA ligase and lead to cell death by inhibiting protein synthesis and cell division. Fosgemcitabine is also known as palabenamide, which is a synthetic compound that acts as a selective inhibitor of the ion channel TRPM2. The binding of palabenamide to TRPM2 leads to inhibition of calcium influx into cells and subsequent cell death. Palabenamide has been shown to inhibit the proliferation of human T-cells and suppress antigen-specific immune responses in mice models.</p>

<p>Ac710 mesylate is a small molecule that is being developed for the treatment of fibrosis. It blocks the activity of collagen-specific TGF-β1 and TGF-β3, which are cytokines that function as signaling molecules in fibrosis. Ac710 mesylate has been shown to inhibit alveolar type II cell proliferation and induce lung fibrosis in mice. The drug was also shown to prevent emphysema development in rats with chronic bronchitis, by reducing protein expression and neutrophil infiltration.</p>

<p>KCNJ13 antibody was raised in Rabbit using Human KCNJ13 as the immunogen</p>

<p>The Myc antibody is a monoclonal antibody that specifically targets the c-Myc protein. It has a high affinity for c-Myc, which is a nuclear biomolecule involved in the regulation of cell growth and proliferation. The Myc antibody can be used in various life sciences research applications to study the role of c-Myc in different cellular processes.</p>

<p>Purified recombinant OCIAD2 protein (His tag)</p>

<p>LRRC26 antibody was raised using the middle region of Lrrc26 corresponding to a region with amino acids LRPLCAWLRRHPLPASEAETVLCVWPGRLTLSPLTAFSDAAFSHCAQPLA</p>

<p>OVA conjugated Sulfamethoxydiazine Hapten</p>

<p>Rabbit polyclonal ITGB6 antibody</p>

<p>Rabbit polyclonal Fetuin B antibody</p>

<p>The SATB1 antibody is a highly specialized monoclonal antibody that has been developed for targeted therapy in various medical applications. This antibody specifically targets and binds to SATB1, a protein that plays a crucial role in gene regulation and cellular function. By binding to SATB1, this antibody can modulate its activity and inhibit the growth of certain cells.</p>

<p>Rabbit polyclonal ACTN4 antibody</p>

<p>Mouse monoclonal APBB3 antibody</p>

<p>POSTN antibody was raised using the middle region of POSTN corresponding to a region with amino acids VTKFIEGGDGHLFEDEEIKRLLQGDTPVRKLQANKKVQGSRRRLREGRSQ</p>

<p>Purified recombinant HNRNPK protein (His tag)</p>

<p>The TDGF1 antibody is a monoclonal antibody that targets E-cadherin, a basic protein involved in cell adhesion. It acts as a neutralizing agent against epidermal growth factor (EGF), a potent growth factor that plays a crucial role in cell proliferation and differentiation. The TDGF1 antibody is widely used in the field of life sciences for various applications, including immunohistochemistry and Western blotting.</p>

<p>This antibody reacts with heavy (gamma) chains on rat IgG and light chains on all rat immunoglobulins.</p>

<p>Rabbit polyclonal CENPA antibody</p>

<p>Purified recombinant CD74 protein (His tag)</p>

<p>BFSP1 antibody was raised using the N terminal of BFSP1 corresponding to a region with amino acids QVESNRQRVRDLEAERARLERQGTEAQRALDEFRSKYENECECQLLLKEM</p>

<p>The CNPase antibody is a monoclonal antibody used in Life Sciences research. It is designed to specifically target and bind to CNPase, a protein involved in myelination. This antibody can be used for various applications, such as immunohistochemistry, Western blotting, and ELISA assays. It has been shown to effectively detect CNPase in human serum and tissues, making it a valuable tool for studying the role of this protein in various biological processes. Additionally, the CNPase antibody has been demonstrated to have high specificity and sensitivity, ensuring accurate and reliable results. With its ability to recognize and bind to CNPase with high affinity, this antibody is an essential tool for researchers in the field of neuroscience and neurobiology.</p>

<p>ALAS2 antibody was raised using the C terminal of ALAS2 corresponding to a region with amino acids PTVPRGEELLRLAPSPHHSPQMMEDFVEKLLLAWTAVGLPLQDVSVAACN</p>

<p>NUP50 antibody was raised using the C terminal of NUP50 corresponding to a region with amino acids TTQSKPVSSPFPTKPLEGQAEGDSGECKGGDEEENDEPPKVVVTEVKEED</p>

<p>Rabbit polyclonal STAT5B antibody (Ser731)</p>

<p>LONRF2 antibody was raised using the middle region of LONRF2 corresponding to a region with amino acids IGISRFRVLSHRHRDGYNTADIEYLEDEKVEGPEYEELAALHDSVHQQSV</p>

<p>The SRF antibody is a polyclonal antibody that targets the Serum Response Factor (SRF). SRF is a transcription factor that plays a crucial role in regulating gene expression, particularly in response to various stimuli such as interleukin-6, cholinergic signaling, and interferon. This antibody is widely used in life sciences research to study the function and regulation of SRF.</p>

<p>Sheep polyclonal Etodolac antibody</p>

<p>Gpt protein is a versatile binding protein that plays a crucial role in the Life Sciences field. It is widely used in various applications such as biomass analysis, hybridization studies, and protein-protein interactions. Gpt protein has the ability to bind to specific target molecules, including annexin, inhibitors, emission factors, viscosity modifiers, osteopontin, neutralizing antibodies, growth factors, and interferons. Its unique properties make it an essential tool for researchers working on Proteins and Antigens. With its high affinity and specificity, Gpt protein enables accurate detection and quantification of target molecules in biological samples. Whether you are conducting research or developing diagnostic assays, Gpt protein is an indispensable component that ensures reliable results.</p>

<p>Purified recombinant TSNAX protein</p>

<p>Purified recombinant CRHBP protein (His tag)</p>

<p>KIF12 antibody was raised in Rabbit using Human KIF12 as the immunogen</p>

<p>KLRA1 antibody was raised using the N terminal of KLRA1 corresponding to a region with amino acids NDQGEIYSTLRFLQSPSESQNRLRPDDTQRPGKTDDKEFSVPWHLIAVTL</p>

<p>Mouse monoclonal DLD antibody</p>

<p>MVK antibody was raised using the N terminal of MVK corresponding to a region with amino acids LAVLAFLYLYLSICRKQRALPSLDIVVWSELPPGAGLGSSAAYSVCLAAA</p>

<p>Purified recombinant POLE3 protein (His tag)</p>