Bioquímicos e reagentes

<p>TNKS antibody was raised using the middle region of TNKS corresponding to a region with amino acids LIKGVERLLGGQQGTNPYLTFHCVNQGTILLDLAPEDKEYQSVEEEMQST</p>

<p>Karyopherin Alpha 5 antibody was raised using a synthetic peptide corresponding to a region with amino acids TVMDSKIVQVALNGLENILRLGEQESKQNGIGINPYCALIEEAYGLDKIE</p>

<p>Abamine is a cytosolic protein that binds to the enzyme carotenoid oxygenase and inhibits its activity. It is an inhibitor of carotenoid biosynthesis in plants, leading to inhibition of plastid function. Abamine has been shown to induce plant nodule formation and enhance the production of carotenoids in vitro, as well as inhibit the expression of genes involved in the response pathway to infection. The chemical structure of abamine is similar to that of a hydroxyl group, which may explain its ability to inhibit carotenoid oxygenase.</p>

<p>OPN1MW antibody was raised in rabbit using the C terminal of OPN1MW as the immunogen</p>

<p>Mouse monoclonal cJUN antibody</p>

<p>RPUSD3 antibody was raised using the middle region of RPUSD3 corresponding to a region with amino acids MVLQLCPVLGDHMYSARVGTVLGQRFLLPAENNKPQRQVLDEALLRRLHL</p>

<p>Purified recombinant TOR1A protein (His tag)</p>

<p>Purified recombinant GINS4 protein</p>

<p>Human Serum Albumin is a stable protein that binds to fatty acids and helps transport them in the circulatory system. It can also bind to other molecules, such as drugs, and help with the transport of these molecules in the bloodstream. The protein is composed of amino acids, which are linked together by peptide bonds. The human serum albumin molecule has four subunits that are connected by disulfide bonds. These subunits are called alpha (α), beta (β), gamma (γ), and delta (δ). Human serum albumin contains many hydrophobic amino acids, which make it soluble in lipids and water. This protein is an important part of energy metabolism because it accepts electrons from fatty acid oxidation and transfers them to electron acceptors such as oxygen or NADPH.</p>

<p>UGT2A3 antibody was raised using the middle region of UGT2A3 corresponding to a region with amino acids GIVVFSLGSLFQNVTEEKANIIASALAQIPQKVLWRYKGKKPSTLGANTR</p>

<p>SLCO1B1 antibody was raised in rabbit using the middle region of SLCO1B1 as the immunogen</p>

<p>Terbufoxon sulfone is a toxic pesticide that belongs to the class of carbamates and organophosphates. It inhibits acetylcholinesterase, an enzyme that breaks down acetylcholine, which is a neurotransmitter responsible for transmitting nerve signals to muscles. Terbufoxon sulfone has been shown to have toxic effects on chrysomelidae (beetles) and other insect species. The active site of terbufoxon sulfone has been analyzed by photometric techniques, which are used to calibrate pesticide residue in food products. Terbufoxon sulfone has also been shown to be effective against coleoptera (insects), with a lethal dose at 100 ppm. Terbufoxon sulfone may also be used as a nutraceutical due to its antioxidant properties.</p>

<p>Nevanimibe is a non-steroidal androgen that has been shown to reduce the size of the adrenal glands. It inhibits 17-hydroxylase activity and prevents the synthesis of 17-hydroxyprogesterone, which is a mineralocorticoid. Nevanimibe also inhibits cellular hypertrophy, an endpoint in clinical laboratory tests. In vitro studies have shown nevanimibe to be effective against adrenocortical carcinoma cells and to inhibit their growth. The drug has been found to be active against some strains of Staphylococcus aureus, but not against Mycobacterium tuberculosis or other acid-fast bacteria.</p>

<p>1-tert-Butyl-3-[2-(3-methoxyphenoxy)-5-nitrophenyl]sulfonylurea is a highly specialized sulfonylurea herbicide. It is synthetically derived from intricate chemical processes involving phenoxy and nitrophenyl compounds. The mode of action involves the inhibition of the acetolactate synthase (ALS) enzyme in susceptible plants. This inhibition disrupts the biosynthesis of branched-chain amino acids, leading to the cessation of cell division and growth in the targeted weed species.</p>

<p>Rat monoclonal Ly6G antibody (allophycocyanin)</p>

<p>The cRel antibody is a powerful tool in the field of Life Sciences. It is an antiviral medicament that specifically targets the cRel molecule, a key player in various cellular processes. This antibody has been extensively tested and validated in human serum assays, where it has shown remarkable specificity and effectiveness.</p>

<p>Inhibitor of Janus kinase JAK3</p>

<p>This antibody reacts with heavy (gamma) chains on rabbit IgG.</p>

<p>Terbufibrol is a protein synthesis inhibitor that belongs to the group of dietary, diagnostic, and pharmacologic agents. It is used in animals for the treatment of atherosclerosis and other conditions. Terbufibrol inhibits cholesterol synthesis by inhibiting mevalonate production. It also has been shown to inhibit cholesterol synthesis in human serum through inhibition of 3-hydroxy-3-methylglutaryl coenzyme A reductase (HMG-CoA), which is an enzyme that catalyzes the conversion of HMG-CoA to mevalonate. Terbufibrol has also been shown to be a plasma marker enzyme for atherogenesis.</p>

<p>EsxB protein is a highly specialized and unique molecule that has various applications in the field of Life Sciences. It can be used as a cholinergic agent, a component in DNA vaccines, and as a target for mouse monoclonal antibodies. The EsxB protein can be detected using techniques such as polymerase chain reaction (PCR) or flow immunoassays with streptavidin-coated paramagnetic particles. Recombinant forms of EsxB protein are available for research purposes.</p>

<p>24:0 Cpe is a research tool that is used in the fields of Cell Biology, Pharmacology, and Ion channels. It is an inhibitor with CAS No. 1883501-62-9 that binds to receptors on the surface of cells. It blocks ligand binding to receptor sites by competing for the receptor site on the cell membrane and preventing ligands from binding. The high purity of this product has been confirmed by HPLC analysis. 24:0 Cpe has been shown to be an activator for ion channels, as well as a ligand for protein interactions and antibody production.</p>

<p>AZD-5153 is a drug that inhibits the activity of epidermal growth factor receptor (EGFR). It has been shown to have potent anticancer effects in cellular and animal models. AZD-5153 has been shown to inhibit tumor growth by blocking EGFR signaling, which prevents the proliferation of cancer cells. This drug also blocks the production of inflammatory cytokines, such as IL-6 and TNF-α, which may be responsible for its anti-inflammatory and immunosuppressive effects. AZD-5153 has also been shown to inhibit HIV infection in vivo models. This drug is not active against other receptors, such as HER2 or VEGFR2.</p>

<p>Rabbit polyclonal SYT9 antibody</p>

<p>Rabbit polyclonal MNK1 antibody (Thr250)</p>

<p>Tat-cyclo-cllfvy is a cell-penetrating peptide, which is a synthetic compound designed for therapeutic applications. It is derived from natural peptide sequences, engineered to facilitate efficient cellular uptake without significant toxicity or disruption of cellular membranes. The mode of action involves the facilitated transport of the peptide across the lipid bilayer of cells, leveraging its amphipathic structure to interact with cellular membranes and enable intracellular delivery of attached therapeutic agents.</p>

<p>For Protein Identification and Quantitation</p>

<p>Phosphatidylcholine (PC) is a major phospholipid in cell membranes. It is also an important component of the myelin sheath, which plays a vital role in the transmission of nerve impulses within the body. PC plays a role in diverse cellular functions and has been shown to be involved in protein interactions, receptor binding, and ion channel activity. It is used as a research tool to study the effects of different substances on animal cells and tissues. Phosphatidylcholine has been shown to inhibit ion channels by competing with magnesium ions for binding sites.</p>

<p>ZNF433 antibody was raised in rabbit using the N terminal of ZNF433 as the immunogen</p>

<p>17Beta-Estradiol 2-acetate is an analog of the hormone estrogen that has been shown to have anticancer properties. It induces apoptosis (programmed cell death) in cancer cells by binding to estrogen receptors and inhibiting protein kinases involved in tumor growth. This drug has been tested in Chinese hamster ovary cells and has been found to be a potent inhibitor of kinase activity. Additionally, 17Beta-Estradiol 2-acetate has been used in combination with the drug tolvaptan to treat urinary tract tumors. This drug is also used as a urine marker for monitoring hormone levels in humans.</p>

<p>ANKRD47 antibody was raised using the N terminal Of Ankrd47 corresponding to a region with amino acids GPAQLQLVREQMAAALRRLRELEDQARTLPELQEQVRALRAEKARLLAGR</p>

<p>Mouse monoclonal NRBP1 antibody</p>

<p>MM-589 TFA is a synthetic compound, which is an engineered chemical designed for biochemical research. It is derived from synthetic organic chemistry, providing a pure and controlled source for experimental applications. The mode of action for MM-589 TFA involves the modulation of the biosynthesis pathway of fatty acids. It acts by interfering with key enzymes involved in the elongation and desaturation steps, thereby altering lipid profiles within cells.</p>

<p>The BID antibody is a growth factor that belongs to the class of monoclonal antibodies. It targets specific chemokines and has been extensively studied in the field of Life Sciences. The BID antibody has shown great potential in various applications, including lysis assays, glycosylation studies, and as a tool for detecting specific proteins in research experiments. This monoclonal antibody has been used to study the role of epidermal growth factor (EGF) signaling pathway and its interaction with β-catenin and caspase-9. Additionally, it has been used as a diagnostic tool for detecting anti-dnp antibodies and as a therapeutic agent in the treatment of HER2-positive breast cancer alongside trastuzumab. With its high specificity and versatility, the BID antibody is an invaluable tool for researchers in various fields.</p>

<p>Haptoglobin antibody was raised using the N terminal of HP corresponding to a region with amino acids MSALGAVIALLLWGQLFAVDSGNDVTDIADDGCPKPPEIAHGYVEHSVRY</p>

<p>Please enquire for more information about TJ191 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>The BMP2 antibody is a highly specialized product in the field of Life Sciences. It is designed to target and inhibit the activity of bone morphogenetic protein 2 (BMP2), a key regulator of various cellular processes. This antibody specifically binds to activated BMP2, preventing its interaction with cellular receptors and downstream signaling pathways.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Trpv6 antibody, catalog no. 70R-8072</p>

<p>Purified recombinant HCVE2 protein (His tag)</p>

<p>Irindalone is a pharmacological compound, classified as a dopamine antagonist, which is developed from synthetic chemical processes. Its mode of action involves the inhibition of dopamine receptors, particularly in the central nervous system. By blocking these receptors, Irindalone alters dopamine-mediated neurotransmission, which may modulate various neurological pathways.</p>

<p>Rabbit polyclonal FOXN4 antibody</p>

<p>GPR52 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>M-110 is a high-pressure homogenizer, which is an advanced instrument primarily derived from mechanical engineering principles. This device operates by rapidly pushing a liquid sample through a narrow orifice under extremely high pressure, typically up to tens of thousands of psi, causing cell disruption and micronization due to intense shear forces and impact mechanisms. The high-pressure action facilitates precise particle size reduction and emulsification, allowing a uniform distribution of particles at the nanoscale.</p>

<p>PANK4 antibody was raised using the middle region of PANK4 corresponding to a region with amino acids LGAIGAFLKGAEQDNPNQYSWGENYAGSSGLMSASPELGPAQRARSGTFD</p>

<p>Rabbit polyclonal OR9A2 antibody</p>

<p>TCS 2314 is a compound that has been shown to have an effect on cancer cells. TCS 2314 was synthesized and characterized as a potential anticancer drug. It is a small molecule with the structure of a carboxylate, which binds to chemokines expressed by cancer cells. Binding of TCS 2314 to chemokines inhibits their ability to bind to receptors on white blood cells, preventing them from being recruited into the tumor environment. The molecular modeling studies indicate that TCS 2314 may also inhibit selectins from binding to leukocytes, which are necessary for the recruitment of monocytes into tumors.</p>

<p>BMS-1166 hydrochloride is a peptide that binds to the AMPA receptor and blocks glutamate binding, which inhibits the activity of the receptor. It is a potent inhibitor of ion channels and has been used as a research tool in cell biology and pharmacology. BMS-1166 hydrochloride is also a ligand for GluR1, which is an ion channel protein that regulates neuronal excitability. BMS-1166 hydrochloride can be used as an experimental tool to study the function of glutamate receptors in various neurological diseases such as epilepsy.</p>

<p>Rabbit polyclonal UBA7 antibody</p>

<p>SOD antibody was raised in rabbit using bovine superoxide dismutase as the immunogen.</p>

<p>4EGI-1 is a small molecule that inhibits the growth of platinum-resistant ovarian cancer cells. It has been shown to induce apoptosis by decreasing the mitochondrial membrane potential and pro-apoptotic proteins. 4EGI-1 also has an antiproliferative effect on muscle cells, which may be due to its ability to decrease cell proliferation and inhibit cellular transformation in tissue culture.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This compound works by binding to DNA-dependent RNA polymerase, inhibiting bacterial growth and preventing transcription and replication. Its effectiveness has been demonstrated through patch-clamp technique studies on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>CD100 antibody was raised in rabbit using residues 147-158 [GKNEDGKGRCPF] of the human CD100 protein as the immunogen.</p>

<p>The SYT1 antibody is a monoclonal antibody that specifically targets the Synaptotagmin-1 (SYT1) antigen. It is widely used in Life Sciences research for various applications, including the detection and analysis of SYT1 expression in cells and tissues. This antibody has been shown to have high specificity and sensitivity, making it a valuable tool for studying the role of SYT1 in synaptic transmission, neurotransmitter release, and other cellular processes.</p>

<p>(R)-Sertaconazole is a crystalline polymorph of sertaconazole, an antifungal drug. The polymorphs of sertaconazole are important diagnostic agents for the identification of fungal infections. (R)-Sertaconazole has also been shown to have anti-fungal and antimicrobial properties against human pathogens such as Candida species, Cryptococcus neoformans, and Aspergillus fumigatus. The most effective form of treatment for these infections is in the form of dry powders containing (R)-sertaconazole. These powders are inhaled by humans to treat respiratory diseases caused by these fungi.</p>

<p>ZNF12 antibody was raised in rabbit using the N terminal of ZNF12 as the immunogen</p>

<p>CSTF2T antibody was raised using the C terminal of CSTF2T corresponding to a region with amino acids AGIQGGGMQGAGIQGVSIQGGGIQGGGIQGASKQGGSQPSSFSPGQSQVT</p>

<p>N-(1-((2-(dimethylamino)ethyl)amino)-2-methyl-1-oxopropan-2-yl)-4-(4-(2-methyl-5-(3,4,5-trihydroxytetrahydrofuran -2-yl)benzyl)phenyl)butanamide is a peptide activator of the human ion channel TRPM8. This peptide has been shown to inhibit the binding of a ligand (AITC) to the human receptor hM3Dq and to activate TRPM8 channels in rat dorsal root ganglion neurons. It has also been shown that this peptide can modulate the activity of voltage gated sodium channels.</p>

<p>CANX antibody was raised in rabbit using the C terminal of CANX as the immunogen</p>

<p>The CD34 antibody is a growth factor that plays a crucial role in microvessel density. This antibody is buffered and colloidal, making it ideal for use in various applications within the Life Sciences field. It is classified as a monoclonal antibody, which means it specifically targets a biomolecule of interest. The CD34 antibody has neutralizing properties and can be used as an immunosuppressant in certain cases. Its effectiveness can be measured through techniques such as electrophoresis and immunoassays. Additionally, this monoclonal antibody has been shown to interact with calmodulin, further highlighting its versatility and potential applications.</p>

<p>Rabbit polyclonal TMEM175 antibody</p>

<p>This antibody reacts with heavy chains on hamster IgG and light chains on all hamster immunoglobulins.</p>

<p>The West Nile virus antibody is a highly effective neutralizing agent that can be used for the detection and treatment of West Nile virus infections. It has been shown to bind to specific viral proteins, preventing the virus from entering host cells and replicating. This antibody is produced using advanced monoclonal antibody technology, ensuring high specificity and potency. In addition to its antiviral properties, this antibody has also been demonstrated to have other beneficial effects. It can activate various immune responses, such as chemokine production and fibrinogen activation, which are essential for controlling viral infections. Furthermore, it has been found to have potential therapeutic applications in the treatment of certain cancers, as it exhibits anti-mesothelin and alpha-fetoprotein activities. With its wide range of applications in both diagnostics and therapeutics, this West Nile virus antibody is an invaluable tool in the field of life sciences.</p>

<p>Purified recombinant REXO1 protein (His tag)</p>

<p>The ENO2 antibody is a highly specialized product that plays a crucial role in various areas of life sciences. This polyclonal antibody is specifically designed to target and detect autoantibodies associated with microvessel density. It utilizes particle chemiluminescence technology, allowing for accurate and efficient detection.</p>

<p>(S)-(-)-pH-797804 is a monoclonal antibody that blocks the receptor for tumor necrosis factor-alpha (TNFα) and is used to treat cancer. It has been shown to have anti-inflammatory effects in animal models of inflammatory bowel disease, arthritis, and colitis. This drug can be administered by intravenous injection or as an injection given directly into the tumor. The most common side effect is low blood pressure, which may require treatment with other medications.</p>

<p>Purified Native Bordetella pertussis toxin protein</p>

<p>GJA3 antibody was raised in Rabbit using Human GJA3 as the immunogen</p>

<p>PF 04991532 is a cyclopentyl compound that has been shown to have antiviral activity against HIV-1 and hepatitis C virus (HCV) in vitro. It also inhibits the production of inflammatory cytokines such as TNF-α and IL-6, and prevents HCV infection by blocking the interaction of Toll-like receptor 4 with its ligand. PF 04991532 also has an effect on axonal growth in rats with hepatic steatosis. PF 04991532 is administered orally, at a dose of 10 mg/kg once daily for 28 days. This treatment was found to be safe and well tolerated. There were no significant changes in pharmacokinetic parameters between the treatment group and the placebo group. The drug is not metabolized by cytochrome P450 enzymes, but it undergoes glucuronidation after being metabolized by other enzymes, resulting in a glucuronide conjugate (PF04991532-G).</p>

<p>7β-Eplerenone is a synthetic steroidal compound with high purity and a molecular weight of 362.6. It is used as a research tool in the field of cell biology, pharmacology, and receptor ligand interactions. This product is an activator of the nuclear receptor, which regulates gene transcription and protein synthesis. 7β-Eplerenone has been shown to inhibit the production of inflammatory cytokines such as tumor necrosis factor alpha (TNF-α) by binding to its receptors on cells. This product also inhibits ion channels such as calcium channels that are involved in neuronal transmission and muscle contraction.</p>

<p>Rabbit polyclonal Collagen XII alpha 1 antibody</p>

<p>CHST14 antibody was raised using a synthetic peptide corresponding to a region with amino acids REYQQRYGAEIVRRYRAGAGPSPAGDDVTFPEFLRYLVDEDPERMNEHWM</p>

<p>9-[(4aR,6R,7R,7aS)-7-hydroxy-2-oxido-2-sulfanylidene-4a,6,7,7a-tetrahydro-4H-furo[3,2-d][1,3,2]dioxaphosphinin-6-yl]-2amino -8bromo-5H-purin-6one is a peptide that can be used as a research tool for studying protein interactions and ligand binding. 9-[(4aR,6R,7R,7aS)-7hydroxy 2oxido 2sulfanylidene 4a 6 7 7atetrahydro 4h fur 3 2 d 1 3 2 dioxaphosphinin 6yl] 2amino 8bromo 5h purin 6one has a high purity and is an inhibitor of ion channels.</p>

<p>FBXW2 antibody was raised using the middle region of FBXW2 corresponding to a region with amino acids SLISRWPLPEYRKSKRGSSFLAGEASWLNGLDGHNDTGLVFATSMPDHSI</p>

<p>PCK1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPQLQNGLNLSAKVVQGSLDSLPQAVREFLENNAELCQPDHIHICDGSEE</p>

<p>LONRF2 antibody was raised using the middle region of LONRF2 corresponding to a region with amino acids FGMCLSAEHAGLSEYGCMLEIKDVRTFPDGSSVVDAIGISRFRVLSHRHR</p>

<p>RHPN1 antibody was raised using the middle region of RHPN1 corresponding to a region with amino acids SVLFNIGALHTQIGARQDRSCTEGARRAMEAFQRAAGAFSLLRENFSHAP</p>

<p>Inhibitor of Aurora A kinase</p>

<p>LY 2087101 is a selective α7 nicotinic acetylcholine receptor (α7NAChR) agonist that has been shown to have therapeutic potential in the treatment of inflammatory diseases, such as rheumatoid arthritis. LY 2087101 binds to the α7NAChR and stimulates it, leading to the release of dopamine. This drug has been found to be beneficial in alleviating psychotic disorders and may be useful in treating nicotine addiction. LY 2087101 also blocks cation channels that are associated with pain and inflammation. This drug has been shown to selectively activate specific types of α7 NAChRs, which can be used as a pharmacological probe for studying their role in physiological processes. LY 2087101 has good pharmacokinetic properties and an oral bioavailability of &gt;90%. It is eliminated by hepatic metabolism via cytochrome P450 enzymes, primarily CYP3A4, with a half-life of approximately 20 hours.</p>

<p>Rabbit polyclonal REX4 antibody</p>

<p>Rabbit polyclonal VEGFC antibody (HRP)</p>

<p>Rabbit polyclonal Chk2 antibody (Thr383)</p>

<p>Agonist of α7-nicotinic acetylcholine receptor</p>

<p>MJN228 is an experimental drug that binds to a specific site on the protein. It is being developed as a potential treatment for obesity, diabetes, and other metabolic diseases. MJN228 has been shown to bind to lipids, which are fatty molecules that are important in metabolism. Binding of MJN228 to these lipids may alter the way they interact with proteins.</p>

<p>Rabbit polyclonal URB1 antibody</p>

<p>Please enquire for more information about Triphenyl[2-(pyrrolidin-1-yl)ethyl]phosphanium bromide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Rabbit polyclonal VPS26A antibody</p>

<p>Rabbit polyclonal HMGB1 antibody (FITC)</p>

<p>Kauniolide is a sesquiterpene lactone that is isolated from the roots of Costus speciosus. It has been shown to have anti-cancer properties and may be used for the treatment of cancer. Kauniolide blocks membrane transporters and induces membrane accumulation of cholesterol, which leads to cell death. It also inhibits the metabolism of cholesterol in cancer cells, leading to an increase in cellular levels of cholesterol and inhibition of protein synthesis. Kauniolide has been shown to be active against leukemia and breast cancer cells. Its mechanism of action is not well understood but it is postulated that its stereoselective nature may play a role in its anticancer effects.</p>

<p>Mouse monoclonal ERCC4 antibody</p>

<p>ZNF365 antibody was raised in rabbit using the N terminal of ZNF365 as the immunogen</p>

<p>18:1 Pi(4)P is a research tool that has been used to study the effects of phospholipids on ion channels and receptors. The compound is an inhibitor of ligand-gated ion channels, such as nicotinic acetylcholine receptors and glycine receptors. It has also been shown to interact with peptides and antibodies. 18:1 Pi(4)P is not expected to have any adverse side effects, but it should be handled with care because it is a potent cytotoxic agent.</p>

<p>5-Chloro-2-(4-fluorophenyl)-4-methyl-6-[3-(1-piperidinyl)propoxy]pyrimidine is a research tool that is used as an activator and ligand for various receptors. It has been shown to activate ion channels, such as calcium channels and sodium channels, and inhibit antibody production. This drug also binds to the extracellular domain of Ligand Receptor Complexes (LRCs) and inhibits cell proliferation by inhibiting protein synthesis. 5-Chloro-2-(4-fluorophenyl)-4-methyl-6-[3-(1-piperidinyl)propoxy]pyrimidine is a high purity compound with CAS No. 1639220–17–9.</p>

<p>The 4EBP1 antibody is a polyclonal antibody that belongs to the class of drug antibodies. It is widely used in life sciences research as an inhibitor and neutralizing agent. This antibody specifically targets and binds to 4EBP1, a family of binding proteins involved in regulating protein synthesis. The 4EBP1 antibody can be used in various applications such as Western blotting, immunoprecipitation, and immunofluorescence. It is buffered and optimized for use in different experimental conditions. Whether you are studying interleukins, ranolazine, or other chimeric proteins, the 4EBP1 antibody is a valuable tool for detecting and analyzing activated proteins. With its high specificity and sensitivity, this monoclonal antibody ensures accurate and reliable results in your research experiments.</p>

<p>Inhibitor of O-methyl-transferases</p>

<p>Mouse monoclonal NTF3 antibody</p>

<p>Rabbit polyclonal TCF3 antibody</p>

<p>Retinoic acid receptor-​related orphan receptor (ROR) modulator</p>

<p>Mouse monoclonal TTC32 antibody</p>

<p>Lwh-63 is a monoclonal antibody that blocks the interaction of proteins. It has been shown to bind to peptides and inhibit the function of ion channels. Lwh-63 is a research tool for use in studies on cell biology, pharmacology, and receptor binding. The chemical name for Lwh-63 hydrochloride is 2-[1-(2-methoxyethoxy)ethyl]benzeneacetic acid, ethyl ester, monosodium salt (1:1). It has a molecular weight of 467.87 g/mol and CAS No. 276890-57-4.</p>

<p>GNG2 antibody was raised in Rabbit using Human GNG2 as the immunogen</p>

<p>Rabbit polyclonal TLP4 antibody</p>