Bioquímicos e reagentes

<p>Rabbit polyclonal WRKY63 antibody</p>

<p>Mouse monoclonal EIF4E2 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This compound works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thereby inhibiting bacterial growth. Its potency has been demonstrated through extensive research using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. The compound undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their growth in culture.</p>

<p>CEACAM6 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVI</p>

<p>Purified Polyclonal BAF53A antibody</p>

<p>1-202 amino acids: MGSSHHHHHH SSGLVPRGSH MCRTLAAFPT TCLERAKEFK TRLGIFLHKS ELGCDTGSTG KFEWGSKHSK ENRNFSEDVL GWRESFDLLL SSKNGVAAFH AFLKTEFSEE NLEFWLACEE FKKIRSATKL ASRAHQIFEE FICSEAPKEV NIDHETRELT RMNLQTATAT CFDAAQGKTR TLMEKDSYPR FLKSPAYRDL AAQASAASAT LSSCSLDEPS HT</p>

<p>Mouse monoclonal ACTN1 antibody</p>

<p>Recombinant Human XPNPEP1 protein with His tag</p>

<p>The Tenascin antibody is a monoclonal antibody that specifically targets the protein tenascin. Tenascin is a large extracellular matrix glycoprotein that plays a role in cell adhesion and migration during embryogenesis and tissue remodeling. This antibody can be used in various research applications, including immunohistochemistry, Western blotting, and flow cytometry.</p>

<p>ITFG1 antibody was raised in Rabbit using Human ITFG1 as the immunogen</p>

<p>Adenovirus antibody was raised in mouse using the hexon group antigen of numerous ADV serotypes as the immunogen.</p>

<p>MOSPD2 antibody was raised using the middle region of MOSPD2 corresponding to a region with amino acids TPLCENGPITSEDETSSKEDIESDGKETLETISNEEQTPLLKKINPTEST</p>

<p>The Kv1.3 antibody is a highly specialized monoclonal antibody with cytotoxic properties. It is used as an immunomodulatory agent and has shown promising results as an anticancer therapy. This antibody works by neutralizing the activity of Kv1.3, a potassium channel that plays a crucial role in cell proliferation and survival.</p>

<p>The NMT2 antibody is a growth factor that targets nuclear epidermal growth factor. It belongs to the class of inhibitors known as monoclonal antibodies. This antibody specifically targets tyrosine and has shown promising results in inhibiting the growth of various cancer cells, including those resistant to other treatments such as trastuzumab. The NMT2 antibody is particularly effective against HER2-positive cancers, as it acts as an anti-HER2 antibody. Additionally, this antibody has shown potential in targeting other proteins such as c-myc, epidermal growth factor, and alpha-synuclein. Its specificity for nucleotide molecules makes it a valuable tool for research and therapeutic applications. With its unique properties and high affinity for its target, the NMT2 antibody offers exciting possibilities in the field of cancer treatment and beyond.</p>

<p>Mouse monoclonal CD158f antibody (PE)</p>

<p>Rabbit polyclonal ROMK antibody (Ser44/25)</p>

<p>The ZFP36 antibody is a substance that acts as an inhibitor and belongs to the class of monoclonal antibodies. It has been used in the field of medicine and life sciences for various applications. The ZFP36 antibody has shown potential as an HDAC inhibitor, which means it can inhibit the activity of histone deacetylases. This inhibition can lead to changes in gene expression and cellular processes.</p>

<p>C17ORF57 antibody was raised using the N terminal Of C17Orf57 corresponding to a region with amino acids CGEEKSSDFSGEKKVGRKSLQVQQHSKRTEIIPPFLKLSKEKVTRKENSL</p>

<p>FGF21 antibody is a monoclonal antibody that specifically targets and inhibits the activity of fibroblast growth factor 21 (FGF21). FGF21 is a growth factor that plays a crucial role in regulating metabolism and energy balance. By blocking the action of FGF21, this antibody can potentially have therapeutic applications in various diseases related to metabolic disorders, such as obesity and type 2 diabetes.</p>

<p>30-241 amino acids: MRGSHHHHHH GMASMTGGQQ MGRDLYDDDD KDRWGSHMFS PYVFNGGTIL AIAGEDFAIV ASDTRLSEGF SIHTRDSPKC YKLTDKTVIG CSGFHGDCLT LTKIIEARLK MYKHSNNKAM TTGAIAAMLS TILYSRRFFP YYVYNIIGGL DEEGKGAVYS FDPVGSYQRD SFKAGGSASA MLQPLLDNQV GFKNMQNVEH VPLSLDRAMR LVKDVFISAA ERDVYTGDAL RICIVTKEGI REETVSLRKD</p>

<p>Purified recombinant CIAO1 protein (His tag)</p>

<p>VPS4A antibody was raised using a synthetic peptide corresponding to a region with amino acids YFLHAIKYEAHSDKAKESIRAKCVQYLDRAEKLKDYLRSKEKHGKKPVKE</p>

<p>Mouse monoclonal PRKAR1B antibody</p>

<p>Occludin antibody was raised using the N terminal of OCLN corresponding to a region with amino acids VRPMLSQPAYSFYPEDEILHFYKWTSPPGVIRILSMLIIVMCIAIFACVA</p>

<p>MGAT5B antibody was raised in Rabbit using Human MGAT5B as the immunogen</p>

<p>Keratin K13 antibody was raised in mouse using Keratin preparation from human esophagus as the immunogen.</p>

<p>The Pgf protein is a growth factor that plays a crucial role in the development and maintenance of pluripotent stem cells. It is commonly used in research laboratories and the pharmaceutical industry. The Pgf protein is produced using advanced techniques such as glycerin-based expression systems and polymerase chain reaction (PCR) amplification. Its purity and quality are ensured through rigorous cytometry analysis and neutralizing assays.</p>

<p>The SHC1 antibody is a highly specialized chemokine that plays a crucial role in various biological processes. It is commonly used in research and life sciences for immobilization and detection purposes. This antibody is available in both polyclonal and monoclonal forms, offering researchers a wide range of options to suit their specific needs.</p>

<p>Mouse monoclonal SERPINB4 antibody</p>

<p>Mouse monoclonal C21orf59 antibody</p>

<p>Eph Receptor A5 antibody was raised using the middle region of EPHA5 corresponding to a region with amino acids SDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAYTTRGGKIP</p>

<p>The CEA antibody is a powerful growth factor that plays a crucial role in various biological processes. It interacts with transferrin and TNF-α to regulate hepatocyte growth and function. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications. One notable application is its use as a targeted therapy. The CEA antibody, when conjugated with other therapeutic agents such as trastuzumab (anti-HER2 antibody), can specifically target cancer cells that overexpress certain markers, leading to their selective destruction. This targeted approach minimizes damage to healthy cells and reduces side effects. Additionally, the CEA antibody has been found to be an effective tool in research and diagnostics. It can be used as an activated electrode for the detection of specific biomarkers, such as annexin or chemokines, allowing for precise measurements and analysis. Moreover, monoclonal antibodies against CEA have been developed for the detection and quantification of CEA levels</p>

<p>C10ORF12 antibody was raised using the middle region of C10Orf12 corresponding to a region with amino acids LPKAEVQSKRKRTEGSSPPDSKNKGPTVKASKEKHADGATKTPAAKRPAA</p>

<p>Mouse monoclonal FCGR2A antibody</p>

<p>The SAT1 antibody is a polyclonal antibody that specifically targets the activated form of an oncogenic kinase. It is widely used in Life Sciences research for various applications, including immunoassays and protein detection. This antibody can be immobilized on surfaces such as microplates or beads for easy and efficient binding to its target protein. The SAT1 antibody has been extensively validated and shown to have high specificity and sensitivity in detecting the growth factor it binds to. It is available in both monoclonal and polyclonal forms, allowing researchers to choose the best option for their specific needs. With its ability to bind to specific epitopes on the target protein, this antibody serves as a valuable tool for studying the role of growth factors and their interactions with other proteins. Whether you are conducting basic research or developing therapeutic inhibitors, the SAT1 antibody is an essential component in your toolkit.</p>

<p>TMCC1 antibody was raised using the middle region of TMCC1 corresponding to a region with amino acids YQSYERARDIQEALEACQTRISKMELQQQQQQVVQLEGLENATARNLLGK</p>

<p>Mouse monoclonal SDR9C7 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ADAM19 antibody, catalog no. 70R-7210</p>

<p>The CD27 antibody is a monoclonal antibody that targets the CD27 protein, which plays a crucial role in immune response and cell signaling. This antibody is widely used in life sciences research to study the function and regulation of CD27. It has been shown to inhibit the growth of certain cancer cells by blocking the interaction between CD27 and its ligand. Additionally, the CD27 antibody has been found to have anti-inflammatory properties and can modulate immune responses by promoting the production of interleukin-6 and other cytokines. Its acidic nature allows for efficient binding to target cells, making it an effective tool for various experimental techniques such as flow cytometry and immunohistochemistry. The CD27 antibody is a valuable asset in understanding the complex mechanisms of immune regulation and holds great potential for therapeutic applications in the future.</p>

<p>ZNF534 antibody was raised in rabbit using the middle region of ZNF534 as the immunogen</p>

<p>Cpne6 antibody was raised in rabbit using the C terminal of Cpne6 as the immunogen</p>

<p>Purified Polyclonal PLC gamma 1 antibody</p>

<p>GPR77 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Rabbit polyclonal SECP43 antibody</p>

<p>DHODH antibody was raised using the middle region of DHODH corresponding to a region with amino acids NLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAEL</p>

<p>BXDC2 antibody was raised in Rabbit using Human BXDC2 as the immunogen</p>

<p>Purified Rabbit polyclonal GOSR1 antibody</p>

<p>The TP53 antibody is a glycoprotein that specifically targets the TP53 protein, also known as the tumor protein p53. This antibody is widely used in life sciences research to study the expression and function of TP53. It can be used in various applications such as Western blotting, immunohistochemistry, and immunoprecipitation. The TP53 antibody has been shown to have high specificity and sensitivity in detecting TP53 in nuclear extracts and human serum samples. This monoclonal antibody recognizes both wild-type and mutant forms of TP53, making it a valuable tool for studying the role of TP53 in cancer development and progression. With its superior performance and reliable results, the TP53 antibody is an essential reagent for researchers in the field of molecular biology and oncology.</p>

<p>Human IgA antibody was raised in goat using human secretory IgA as the immunogen.</p>

<p>Purified recombinant HLA-DOA protein (His tag)</p>

<p>Purified native Pig Troponin I protein (Cardiac)</p>

<p>ESR1 antibody was raised in Mouse using a purified recombinant fragment of human ESR1 expressed in E. coli as the immunogen.</p>

<p>Rabbit polyclonal GOT2 antibody (biotin)</p>

<p>SLC5A3 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>DGCR2 antibody was raised using the middle region of DGCR2 corresponding to a region with amino acids AESCYEKSSFLCKRSQTCVDIKDNVVDEGFYFTPKGDDPCLSCTCHGGEP</p>

<p>Purified Polyclonal STK31 antibody</p>

<p>The CD66a antibody is a highly potent and cytotoxic antibody that plays a crucial role in growth factor signaling. With its unique structure consisting of acid residues, this antibody specifically targets and inhibits endothelial growth factors, preventing the formation of new blood vessels.</p>

<p>MDVFMKGLSK AKEGVVAAAE KTKQGVAEAA GKTKEGVLYV GSKTKEGVVH GVATVAEKTK EQVTNVGGAV VTGVTAVAQK TVEGAGSIAA ATGFVKKDQL GKEGYQDYEP EA</p>

<p>GSTT2B antibody was raised in Rabbit using Human GSTT2B as the immunogen</p>

<p>Armenian Hamster monoclonal CD3 antibody (FITC)</p>

<p>CLTA antibody was raised in rabbit using the C terminal of CLTA as the immunogen</p>

<p>NUDT17 antibody was raised using a synthetic peptide corresponding to a region with amino acids YPPRLSWGLPKYHHIVLYLLVISQESQQQLQARIQPNPNEVSALMWLTPD</p>

<p>Rabbit polyclonal VPS33A antibody</p>

<p>Mouse brain antibody was raised in rabbit using brain tissue from C3H mice as the immunogen.</p>

<p>Rabbit polyclonal APC5 antibody (FITC)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MRPL39 antibody, catalog no. 70R-2412</p>

<p>The LKB1 antibody is a phosphatase that plays a crucial role in various cellular processes. It is a polyclonal antibody commonly used in the field of Life Sciences. This antibody specifically targets the chemokine colony-stimulating factor and can be used for neutralizing its effects. Additionally, monoclonal antibodies against LKB1 are available, which have been shown to be effective in detecting autoantibodies present in human serum samples. The LKB1 antibody is also known to interact with other proteins, such as epidermal growth factor, and can be used for studying their signaling pathways. With its high specificity and sensitivity, this antibody is an invaluable tool for researchers working in the field of molecular biology and cell biology.</p>

<p>Purified recombinant DLX3 protein (His tag)</p>

<p>ZNF384 antibody was raised in mouse using recombinant Human Zinc Finger Protein 384</p>

<p>Rabbit polyclonal ATG4C antibody</p>

<p>Desmocollin 3 antibody was raised in mouse using synthetic peptide corresponding to a sequence present on the extracellular anchor domain of human desmocollin 3 as the immunogen.</p>

<p>PARP2 antibody was raised in rabbit using residues 43-59 [QRQESKKMPVAGGKANK] of the 62 kDa human PARP-2 protein as the immunogen.</p>

<p>LIG1 antibody was raised in Rabbit using Human LIG1 as the immunogen</p>

<p>The eIF4G antibody is a highly specific and potent antibody that is used in the field of Life Sciences. It is available as both polyclonal and monoclonal antibodies, providing researchers with options to suit their specific needs. This antibody has been extensively tested and proven to be effective in neutralizing adiponectin, a hormone produced by adipose tissue that plays a crucial role in regulating metabolism.</p>

<p>CRLF1 antibody was raised using the middle region of CRLF1 corresponding to a region with amino acids QLSVRWVSPPALKDFLFQAKYQIRYRVEDSVDWKVVDDVSNQTSCRLAGL</p>

<p>This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.</p>

<p>Mouse monoclonal NLN antibody</p>

<p>RASH antibody is a highly specialized antibody used in transfer reactions and immunoassays within the field of Life Sciences. It is specifically designed to target VEGF (vascular endothelial growth factor), making it an ideal tool for studying angiogenesis and related processes. RASH antibody comes in both polyclonal and monoclonal forms, allowing researchers to choose the best option for their specific needs.</p>

<p>The Cytochrome P450 2D6 antibody is a polyclonal antibody that specifically targets and binds to the cytochrome P450 2D6 enzyme. This enzyme plays a crucial role in drug metabolism, particularly in the metabolism of many commonly prescribed medications. The antibody recognizes the specific amino acid sequence of the cytochrome P450 2D6 enzyme and can be used for various applications in life sciences research.</p>

<p>Purified Polyclonal BMP8B antibody</p>

<p>Mouse monoclonal RASSF1 antibody</p>

<p>Ribonuclease A antibody was raised in rabbit using bovine pancreatic ribonuclease A as the immunogen.</p>

<p>CD49B antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>SNRP70 antibody was raised using a synthetic peptide corresponding to a region with amino acids PHNDPNAQGDAFKTLFVARVNYDTTESKLRREFEVYGPIKRIHMVYSKRS</p>

<p>Purified Polyclonal APAF1 antibody</p>

<p>The RPS19 antibody is a high-quality polyclonal antibody used in life sciences research. It is specifically designed to target and detect the protein RPS19, which plays a crucial role in adiponectin production. This antibody can be used in various applications, including immunohistochemistry, Western blotting, and ELISA.</p>

<p>ApoE antibody was raised using the N terminal of APOE corresponding to a region with amino acids KVLWAALLVTFLAGCQAKVEQAVETEPEPELRQQTEWQSGQRWELALGRF</p>

<p>Rabbit Polyclonal CDC2 antibody (Thr161)</p>

<p>Rabbit antigen staining reagent for use in IHC</p>

<p>SLC25A24 antibody was raised using a synthetic peptide corresponding to a region with amino acids MDSLYGDLFWYLDYNKDGTLDIFELQEGLEDVGAIQSLEEAKKIFTTGDV</p>

<p>Rabbit polyclonal SDCCAG3 antibody</p>

<p>The GLO1 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and bind to the glyoxalase 1 enzyme, which plays a crucial role in detoxifying harmful reactive carbonyl compounds. This antibody has been extensively studied for its potential antiviral properties and has shown promising results in inhibiting viral replication.</p>

<p>Mouse monoclonal PIK3AP1 antibody</p>

<p>LSS antibody was raised in Rabbit using Human LSS as the immunogen</p>

<p>VPS37C antibody was raised using a synthetic peptide corresponding to a region with amino acids LQLEREMALATNRSLAERNLEFQGPLEISRSNLSDRYQELRKLVERCQEQ</p>

<p>The RCC1 antibody is a serum marker that is used in various assays and research in the field of Life Sciences. It is a monoclonal antibody that specifically targets RCC1, an important protein involved in cell cycle regulation. This antibody can be used to detect the presence of RCC1 in biological samples, making it a valuable tool for studying its expression and function. Additionally, the RCC1 antibody has been shown to have potential therapeutic applications, as it can be used to develop targeted medicines against diseases associated with abnormal RCC1 levels. With its high specificity and sensitivity, this antibody is widely used by researchers and scientists in their studies on sirtuins, interleukins, carnitine metabolism, and antiviral mechanisms.</p>

<p>The NEU2 antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody has been specifically designed to neutralize the toxic effects of alpha-fetoprotein (AFP) in human serum. By binding to AFP, the NEU2 antibody prevents its interaction with cell surface receptors and inhibits its downstream signaling pathways. This inhibition leads to a decrease in the production of colony-stimulating factors and other growth factors that are essential for tumor growth and metastasis.</p>

<p>Purified recombinant WBP2 protein (His tag)</p>

<p>Norfloxacin N Conjugate for use in immunoassays</p>

<p>Mouse monoclonal PTPN11 antibody</p>