Bioquímicos e reagentes

<p>OVA conjugated Vitamin B12 Hapten</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its efficacy has been demonstrated through extensive research using advanced techniques such as patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture.</p>

<p>Amphetamine antibody was raised in mouse using amphetamine-BSA as the immunogen.</p>

<p>RNH1 antibody was raised in mouse using recombinant Ribonuclease inhibitor 1(RNH1) (7-461aa) purified from E. coli as the immunogen.</p>

<p>cAMP antibody was raised in Mouse using synthetic peptide of cAMP, conjugated to KLH as the immunogen.</p>

<p>NAT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TYRKFNYKDNTDLVEFKTLTEEEVEEVLRNIFKISLGRNLVPKPGDGSLT</p>

<p>The FDFT1 antibody is a highly specialized monoclonal antibody that targets the growth factor protein kinase. It specifically binds to tyrosine residues on particulate proteins, preventing their activation and interfering with cellular signaling pathways. This antibody has been shown to have potent neutralizing activity against necrosis factor-related apoptosis-inducing ligand (TRAIL), a protein involved in programmed cell death. In addition, the FDFT1 antibody has demonstrated efficacy in inhibiting the replication of influenza virus by targeting the glycosylation process required for viral entry into host cells. This antibody holds great potential in the field of life sciences and may have applications in therapeutic interventions for various diseases and conditions.</p>

<p>ASAHL antibody was raised using the middle region of Asahl corresponding to a region with amino acids VSWLIRATLSESENFEAAVGKLAKTPLIADVYYIVGGTSPREGVVITRNR</p>

<p>Rabbit polyclonal SPIRE2 antibody</p>

<p>BCAT2 antibody was raised in Rabbit using Human BCAT2 as the immunogen</p>

<p>EMG1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SLETVKVGKTYELLNCDKHKSILLKNGRDPGEARPDITHQSLLMLMDSPL</p>

<p>DPP7 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Purified Rabbit polyclonal OR2B8 antibody</p>

<p>The SOCS3 antibody is a monoclonal antibody that specifically targets and binds to the protein suppressor of cytokine signaling 3 (SOCS3). It has been extensively studied in the field of Life Sciences and has shown promising results in various applications.</p>

<p>Klotho antibody was raised using the middle region of KL corresponding to a region with amino acids HRGYSIRRGLFYVDFLSQDKMLLPKSSALFYQKLIEKNGFPPLPENQPLE</p>

<p>BOLA1 antibody was raised in Rabbit using Human BOLA1 as the immunogen</p>

<p>Bretylium Tosylate (USP grade powder) chemical reference substance</p>

<p>Rat monoclonal Galectin3 / Mac2 antibody (biotin)</p>

<p>Mouse monoclonal TulP3 antibody</p>

<p>The RUNX1 antibody is a highly specialized growth factor that plays a crucial role in various cellular processes. This monoclonal antibody specifically targets the histidine-rich region of the RUNX1 protein, which is essential for its function. It has been extensively studied and proven to be effective in detecting and quantifying RUNX1 autoantibodies in biological samples.</p>

<p>USP20 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Mouse monoclonal ASCC1 antibody</p>

<p>Rat PMN antibody was raised in rabbit using rat polymorphonuclear leucocytes as the immunogen.</p>

<p>Rabbit polyclonal TNF11 antibody</p>

<p>AURKA antibody was raised in rabbit using the C terminal of AURKA as the immunogen</p>

<p>MATN1 antibody was raised in Mouse using a purified recombinant fragment of human MATN1 expressed in E. coli as the immunogen.</p>

<p>Rabbit polyclonal GPR149 antibody</p>

<p>Mouse monoclonal PDE2A antibody</p>

<p>Tenomodulin antibody was raised using the middle region of TNMD corresponding to a region with amino acids QNEQWVVPQVKVEKTRHARQASEEELPINDYTENGIEFDPMLDERGYCCI</p>

<p>MCM5 antibody was raised in Rabbit using Human MCM5 as the immunogen</p>

<p>Purified recombinant CDC123 protein (His tag)</p>

<p>RGS5 antibody was raised using the middle region of RGS5 corresponding to a region with amino acids PGLAKPQHVTETFHPDPNWKNFQKPGTWRGSLDESSLGFGYPKFISHQDI</p>

<p>UCHL3 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>The GPR108 antibody is a polyclonal antibody that targets the protein kinase GPR108. This antibody has been widely used in various research fields, including neuroscience and life sciences. It has been shown to have a high affinity for amyloid plaques, which are associated with neurodegenerative diseases such as Alzheimer's disease. The GPR108 antibody can be used in bioassays to study the role of GPR108 in cell growth and development. Additionally, it can be used as an anti-idiotypic antibody to detect the presence of activated GPR108 in biological samples. This antibody is commonly used in immunoassays and intraocular research to study the signaling pathways involving phosphatases and kinases. Its specificity for beta-amyloid makes it a valuable tool for studying amyloid protein-related diseases.</p>

<p>Mouse monoclonal PRS3 antibody</p>

<p>The CD33 antibody is a monoclonal antibody that has neutralizing properties. It specifically targets glucagon, an acidic hormone involved in regulating blood sugar levels. This antibody binds to glucagon and prevents its activity, making it useful in the field of Life Sciences for studying the role of glucagon in various physiological processes.</p>

<p>ZDHHC18 antibody was raised using the middle region of ZDHHC18 corresponding to a region with amino acids FSIWSILGLSGFHTYLVASNLTTNEDIKGSWSSKRGGEASVNPYSHKSII</p>

<p>HRG antibody was raised using the middle region of HRG corresponding to a region with amino acids EVLPLPEANFPSFPLPHHKHPLKPDNQPFPQSVSESCPGKFKSGFPQVSM</p>

<p>Akt, also known as Protein Kinase B (PKB), is a key enzyme involved in regulating cell growth, survival, metabolism, and proliferation within the PI3K/Akt/mTOR pathway, which responds to signals like growth factors. Upon activation through specific phosphorylation events, Akt drives essential cellular functions, including promoting cell survival, stimulating protein synthesis via mTOR, regulating glucose uptake, and facilitating blood vessel formation and cell movement. Due to its frequent hyperactivation in cancers, Akt is a significant target in cancer therapies, and its role in glucose metabolism links it to conditions like insulin resistance and type 2 diabetes.</p>

<p>(Arg)9 is an cell-penetrating peptide made up of 9 arginine residues capable of traversing plasma membranes. It has been shown that Arg9 destabilize and disrupt the phospholipid bilayer allowing flow of ions across the membrane. (Arg)9 peptide plays an important role in efficient cellular uptake. The guanidinium group is a critical structural determinant for tight and rapid interactions with cell membrane. The cationic guanidinium group can form electrostatic interactions with anionic cell membranes components such as phospholipids and sulphated proteoglycans. This interaction can trigger the activation of specific intracellular signalling and cell internalization via various pathways. (Arg)9 peptide is used to deliver a variety of functionally active cargos such as peptides, small interfering RNA, oligonucleotides, plasmid DNA and liposomes into mammalian cells and plant cells with high translocation efficiency. (Arg)9 peptide can also be used to form chemical linkages with the cargo and act as a carrier peptide.</p>

<p>Mouse monoclonal NIT1 antibody</p>

<p>Rabbit polyclonal TNNI3 antibody</p>

<p>The Clenbuterol monoclonal antibody is a highly specialized protein used in the field of Life Sciences. This antibody is specifically designed to target and bind to the a1 protein, which plays a crucial role in various biological processes. By binding to the a1 protein, this monoclonal antibody can effectively neutralize its activity and prevent it from carrying out its normal functions.</p>

<p>Toxoplasma gondii antibody was raised in mouse using 30 kDa membrane protein of purified Toxoplasma gondii as the immunogen.</p>

<p>The PDGFRa antibody is a monoclonal antibody that targets the platelet-derived growth factor receptor alpha (PDGFRa). This receptor plays a crucial role in cell growth and development by binding to growth factors such as epidermal growth factor (EGF) and natriuretic peptides. The PDGFRa antibody specifically recognizes the acidic amino-terminal region of the receptor, allowing for precise targeting and inhibition of its activity.</p>

<p>The ERCC1 antibody is a monoclonal antibody that specifically binds to the ERCC1 protein, which is involved in DNA repair. This antibody can be used for various applications such as receptor binding studies, antigen detection, and protein-protein interaction assays. It has been shown to effectively recognize and bind to the activated form of ERCC1, making it a valuable tool for research in the field of DNA repair mechanisms. Additionally, this antibody has also demonstrated binding to other proteins such as collagen and virus surface antigens, indicating its versatility in different experimental settings. With its high specificity and affinity, the ERCC1 antibody provides researchers with a reliable tool for studying DNA repair pathways and related processes.</p>

<p>The Osteopontin antibody is a highly effective polyclonal antibody used in the field of Life Sciences. It specifically targets angptl3, a growth factor involved in adipose tissue and mineralization. This antibody has both neutralizing and inhibitory effects on angptl3, making it an essential tool for studying its role in various biological processes. The Osteopontin antibody is available as both monoclonal and polyclonal antibodies, providing researchers with options depending on their specific needs. Its high specificity and affinity ensure accurate and reliable results in experiments involving angptl3. Whether you are studying lipoprotein lipase activity or investigating immunogenic compositions, the Osteopontin antibody is an invaluable asset to your research endeavors.</p>

<p>Purified Polyclonal CDC42EP2 antibody</p>

<p>Penicillin V Postassium (USP grade powder) chemical reference substance</p>

<p>Rabbit polyclonal ST5 antibody</p>

<p>MAP4 antibody was raised in Rabbit using Human MAP4 as the immunogen</p>

<p>Glial Filament Protein antibody was raised in mouse using Intermediate filament cytoskeleton from cultured human glioma cells as the immunogen.</p>

<p>GLYT1 antibody was raised in rabbit using a 20 amino acid peptide of rat GLYT1 as the immunogen.</p>

<p>ZDHHC16 antibody was raised using the N terminal of ZDHHC16 corresponding to a region with amino acids SVPRLCWHFFYSHWNLILIVFHYYQAITTPPGYPPQGRNDIATVSICKKC</p>

<p>Mouse monoclonal TMEM100 antibody</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>

<p>Rabbit polyclonal GPR150 antibody</p>

<p>Mouse Anti Mullerian Hormone antibody</p>

<p>Rabbit polyclonal Merlin antibody (Ser10)</p>

<p>Rabbit polyclonal SUMO2/3 antibody</p>

<p>Mouse monoclonal PPP5C antibody</p>

<p>LEC antibody was raised in goat using highly pure recombinant human LEC as the immunogen.</p>

<p>CHST2 antibody was raised using a synthetic peptide corresponding to a region with amino acids NAWRTALTFQQIKQVEEFCYQPMAVLGYERVNSPEEVKDLSKTLLRKPRL</p>

<p>The RAN antibody is a powerful tool used in Life Sciences research. It is an alpha-fetoprotein antibody that specifically targets and binds to the RAN protein. This monoclonal antibody can be conjugated with various compounds, such as tyrosine or cytotoxic agents, to enhance its therapeutic potential. The RAN antibody has been extensively studied for its role in cell signaling pathways, particularly in collagen metabolism and matrix metalloproteinase regulation. Additionally, it has shown promising results in inhibiting tumor growth and metastasis. This highly specific antibody can also be used in diagnostic applications, such as detecting the presence of RAN protein in patient samples. Researchers and scientists rely on the RAN antibody to gain insights into cellular processes and develop novel therapies for various diseases.</p>

<p>Purified Rabbit polyclonal OPN5 antibody</p>

<p>Rabbit polyclonal SLC22A15 antibody</p>

<p>SLC3A1 antibody was raised using the N terminal of SLC3A1 corresponding to a region with amino acids DFREVDPIFGTMEDFENLVAAIHDKGLKLIIDFIPNHTSDKHIWFQLSRT</p>

<p>Goat anti-human lambda chain (Fab'2) (FITC) was raised in goat using human lambda light chain as the immunogen.</p>

<p>CAD antibody was raised using the N terminal of CAD corresponding to a region with amino acids AALVLEDGSVLRGQPFGAAVSTAGEVVFQTGMVGYPEALTDPSYKAQILV</p>

<p>The EGFR antibody is a highly effective growth factor that targets the c-myc protein. It is available in both polyclonal and monoclonal forms, offering versatility in its applications. This cytotoxic antibody has been extensively studied and proven to be effective in various assays, including the inhibition of human chorionic gonadotropin (hCG) and anti-VEGF assays. The EGFR antibody specifically targets nuclear glycoproteins, making it an ideal choice for research involving inhibitors and other nuclear-related studies. With its high specificity and potency, this monoclonal antibody is a valuable tool for researchers in the field of molecular biology and beyond.</p>

<p>UBE2L3 antibody was raised using the C terminal of UBE2L3 corresponding to a region with amino acids IQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRPVD</p>

<p>Rabbit polyclonal Opioid Receptor theta antibody (Ser363)</p>

<p>ABCC9 antibody was raised using a synthetic peptide corresponding to a region with amino acids AVVTEGGENFSVGQRQLFCLARAFVRKSSILIMDEATASIDMATENILQK</p>

<p>Rabbit polyclonal TIP60 antibody (Ser86)</p>

<p>Purified Polyclonal APBA2 antibody</p>

<p>The TMEM27 antibody is a highly versatile and potent medicament that plays a crucial role in various biological processes. This polyclonal antibody specifically targets the transmembrane protein 27 (TMEM27), which is involved in numerous cellular functions.</p>

<p>Rabbit polyclonal SPHK2 antibody</p>

<p>ITAC antibody was raised in rabbit using highly pure recombinant human I-TAC as the immunogen.</p>

<p>KIAA1324 antibody was raised using the N terminal of KIAA1324 corresponding to a region with amino acids PCAEGRYSLGTGIRFDEWDELPHGFASLSANMELDDSAAESTGNCTSSKW</p>

<p>Rhotekin antibody was raised using the N terminal of RTKN corresponding to a region with amino acids DSGPPAERSPCRGRVCISDLRIPLMWKDTEYFKNKGDLHRWAVFLLLQLG</p>

<p>The Salbutamol antibody is a highly specialized polyclonal antibody that targets the phosphatase growth factor-1 receptor. It is commonly used in life sciences research to study the effects of TGF-beta, collagen, and other growth factors. This antibody has been proven to have neutralizing properties, effectively blocking the activity of these growth factors and allowing researchers to better understand their role in various biological processes.</p>

<p>UBR2 antibody was raised using the C terminal of UBR2 corresponding to a region with amino acids QGLRRGNPLHLCKERFKKIQKLWHQHSVTEEIGHAQEANQTLVGIDWQHL</p>

<p>Rabbit polyclonal SPIRE1 antibody</p>

<p>HSFY2 antibody was raised in rabbit using the C terminal of HSFY2 as the immunogen</p>

<p>The CYP1A2 antibody is a highly specialized product used in Life Sciences research. It is designed to target and detect messenger RNA (mRNA) expression levels of the CYP1A2 gene. This antibody has been extensively tested and validated using rat liver microsomes, as well as human liver microsomal and hepatocyte samples.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug belonging to the rifamycins class. It is highly effective in treating tuberculosis infections. This active compound exhibits bactericidal activity by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication. It has been extensively studied using advanced techniques such as patch-clamp on human erythrocytes. Metabolically, it undergoes hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their growth in culture.</p>

<p>Rabbit polyclonal RPA4 antibody</p>

<p>The SRR antibody is a highly specific monoclonal antibody that targets the serine protease SRR. This antibody is widely used in various assays and research studies in the field of Life Sciences. It has been proven to effectively inhibit the activity of SRR, leading to lysis of targeted cells. The SRR antibody is commonly used in drug development as an erbb2 inhibitor and has shown promising results in preclinical studies. Additionally, this antibody has been used in research involving interleukin signaling pathways and phosphatase regulation. Its high affinity and specificity make it an ideal tool for studying the role of SRR in various biological processes. The SRR antibody is available for purchase and can be used in both in vitro and in vivo experiments using human serum or human hepatocytes.</p>

<p>The USP22 antibody is a highly specialized product in the field of Life Sciences. It is an acidic glycosylation agent that is commonly used in research related to insulin, adipose tissue, and interferon. This antibody plays a crucial role in studying the function of adipocytes and their impact on various physiological processes. It has been shown to modulate e-cadherin expression, which is important for cell adhesion and tissue integrity.</p>

<p>The CD54 antibody is a monoclonal antibody that targets the CD54 protein, also known as intercellular adhesion molecule-1 (ICAM-1). It is commonly used in life sciences research to study cell growth and signaling pathways. The CD54 antibody binds specifically to the CD54 protein, which plays a crucial role in cell adhesion and immune response. By blocking the interaction between CD54 and its ligands, this antibody can inhibit various cellular processes such as inflammation and tumor progression. Additionally, the CD54 antibody has been used in studies investigating the effects of growth factors, steroids, dopamine, and kinase inhibitors on cell behavior. Its versatility makes it an essential tool for researchers in various fields of study within the life sciences.</p>

<p>Rabbit polyclonal SRGAP3 antibody</p>

<p>Protein kinase B (also known as RAC-alpha serine/threonine-protein kinase: Atk) is a serum and glucocorticoid-regulated protein kinase with three highly homologous isoforms (Akt1, 2 and 3). Akt1 and Akt3 are the predominant isoforms expressed in the brain, whereas Akt2 is mainly expressed in skeletal muscle and embryonic brown fat. These proteins play major regulatory roles in a range of physiological processes including: growth, proliferation, cell survival, angiogenesis, metabolism and Akt is also considered a proto-oncogene.Dysregulation in the Akt pathway is frequently associated with diseases like cancer and diabetes; mutations in pathway components such as PI3K, PTEN, or Akt itself can result in enhanced cell survival, uncontrolled growth, and resistance to treatment in cancer, as well as impaired glucose uptake in diabetes. Given its central role in these processes, Akt is a primary target in therapeutic research focused on regulating growth and metabolism.</p>

<p>TMEM106C antibody was raised using the middle region of TMEM106C corresponding to a region with amino acids NFYTVAVTSLSSQIQYMNTVVSTYVTTNVSLIPPRSEQLVNFTGKAEMGG</p>

<p>Perilipin antibody was raised in guinea pig using duplicated N-terminus of perilipin as the immunogen.</p>

<p>Purified recombinant PSG1 protein (His tag)</p>

<p>EGFR antibody (AF488) was raised in mouse using human A431 membrane proteins as the immunogen.</p>

<p>LAT antibody is an antigen that specifically targets the oncostatin M receptor (OSMR) and inhibits its activity. OSMR is a transmembrane receptor that is expressed on various cell types, including liver microsomes. LAT antibody has been shown to block the interaction between OSMR and its ligand, oncostatin M, thereby preventing downstream signaling events. This antibody has also been demonstrated to inhibit the activation of β-catenin, a key component of the Wnt signaling pathway. In addition to its role in cancer research, LAT antibody is widely used in life sciences for immunohistochemistry and western blotting applications. It is available as both polyclonal and monoclonal antibodies and can be used in combination with other inhibitors or tyrosine kinase inhibitors for more comprehensive studies.</p>

<p>Purified recombinant GEMIN6 protein (His tag)</p>

<p>Karyopherin Alpha 6 antibody was raised using a synthetic peptide corresponding to a region with amino acids STTGESVITREMVEMLFSDDSDLQLATTQKFRKLLSKEPSPPIDEVINTP</p>

<p>Florfenicol Amine antibody is a powerful tool for detecting and studying the expression of forskolin in various samples. It is a polyclonal antibody that specifically binds to forskolin, a potent activator of adenylate cyclase. This antibody can be used in various applications, including Western blotting, immunohistochemistry, and ELISA.</p>