Bioquímicos e reagentes

<p>Mouse monoclonal LDHB antibody</p>

<p>Affinity purified Rabbit polyclonal C9orf98 antibody</p>

<p>Rabbit polyclonal CLIP1 antibody</p>

<p>Rabbit polyclonal SGTA antibody</p>

<p>OLFML1 antibody was raised using the middle region of OLFML1 corresponding to a region with amino acids LCGVLYVVYSTGGQGPHRITCIYDPLGTISEEDLPNLFFPKRPRSHSMIH</p>

<p>SF3B1 antibody was raised using the N terminal of SF3B1 corresponding to a region with amino acids SARKNRWDETPKTERDTPGHGSGWAETPRTDRGGDSIGETPTPGASKRKS</p>

<p>AGFG1 antibody was raised in Rabbit using Human AGFG1 as the immunogen</p>

<p>Purified recombinant Human HAAO Protein (His tag)</p>

<p>Purified recombinant Human RND3 protein</p>

<p>Rabbit polyclonal PYGB antibody (HRP)</p>

<p>Rabbit polyclonal Pichia Pastoris antibody</p>

<p>Rabbit polyclonal AKR1CL1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ABCF2 antibody, catalog no. 70R-5704</p>

<p>CFLAR antibody was raised in rabbit using the N terminal of CFLAR as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF92 antibody, catalog no. 20R-1238</p>

<p>Purified Polyclonal EB3 antibody</p>

<p>The RAB3D antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is specifically designed to target and bind to the alpha-fetoprotein (AFP) in human serum. Autoantibodies against AFP have been shown to be associated with various diseases, including liver cancer and hepatocellular carcinoma.</p>

<p>Rabbit polyclonal TMPO antibody</p>

<p>The PFKP antibody is a monoclonal antibody that targets the PFKP protein. It is commonly used in life sciences research to study various aspects of cell growth and metabolism. The PFKP protein plays a crucial role in glycolysis, the process by which cells convert glucose into energy. This antibody specifically binds to the PFKP protein, inhibiting its catalase activity and preventing the production of ATP.</p>

<p>Purified Polyclonal CNT1 antibody</p>

<p>Rabbit polyclonal AurB antibody (Thr232)</p>

<p>The Lamin B1 antibody is a highly specific monoclonal antibody that targets the lamin B1 protein. This protein plays a crucial role in maintaining the structural integrity of the cell nucleus and is involved in various cellular processes. The Lamin B1 antibody has been extensively tested and validated for its high affinity and specificity towards lamin B1.</p>

<p>Rabbit polyclonal EPHB1/2/3 antibody</p>

<p>Mouse monoclonal PTPN1 antibody</p>

<p>TSH beta antibody was raised against Human TSH (intact).</p>

<p>Recombinant Human RAB3IL protein</p>

<p>DZIP1 antibody was raised in Rabbit using Human DZIP1 as the immunogen</p>

<p>BRS3 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Rabbit Polyclonal MEK1 antibody (Ser217)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF322A antibody, catalog no. 70R-8375</p>

<p>The Bcl-2 antibody is a powerful tool in the field of immunology. It belongs to the class of polyclonal antibodies and monoclonal antibodies, which are widely used for their neutralizing and cytotoxic effects. This antibody specifically targets Bcl-2, a protein that plays a critical role in regulating cell death (apoptosis). By binding to Bcl-2, this antibody can interfere with its function and induce cell death in cancer cells.</p>

<p>ASNA1 antibody was raised in rabbit using the C terminal of ASNA1 as the immunogen</p>

<p>Region of GRO beta protein corresponding to amino acids VVVASELRCQ CLTTLPRVDF KNIQSLTVTP PGPHCAQTEV IATLKDGHEV CLNPEAPLVQ RIVQKILNKG KAN.</p>

<p>Goat polyclonal He-dcyd antibody</p>

<p>Rabbit Polyclonal HSP90B antibody (Ser226)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KIAA0494 antibody, catalog no. 70R-1815</p>

<p>GAPDH antibody was raised using the middle region of GAPDH corresponding to a region with amino acids KAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNC</p>

<p>The MC1R antibody is a monoclonal antibody that specifically targets the mineralocorticoid receptor (MC1R). It has been shown to interfere with the function of this receptor, which plays a crucial role in regulating various physiological processes. This antibody can be used in life sciences research to study the effects of MC1R activation or inhibition on different cellular pathways.</p>

<p>SNRPN antibody was raised in rabbit using the N terminal of SNRPN as the immunogen</p>

<p>The VAV1 antibody is a highly specialized product in the field of Life Sciences. It is designed to target specific antigens, such as tissue transglutaminase and brain natriuretic peptide, in human serum. This monoclonal antibody has been extensively tested and proven to have high affinity and specificity for its target antigens.</p>

<p>QRSL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SYSKQYREKRKQNPHSENEDSDWLITGGSSGGSAAAVSAFTCYAALGSDT</p>

<p>The PIG3 antibody is a growth factor that specifically targets epidermal growth factor (EGF). It acts as a neutralizing agent against EGF, preventing its activity and downstream signaling pathways. This monoclonal antibody is derived from histidine and has been extensively studied in the field of life sciences. It has shown promising results in preclinical studies as a potential therapeutic agent for various diseases.</p>

<p>The D-dimer antibody is a highly specialized product used in the field of Life Sciences. It is an electrode-activated monoclonal antibody that exhibits cytotoxic properties. This antibody specifically targets transthyretin and acts as an anti-connexin agent. It is commonly used in various assays and tests to detect the presence of D-dimer in human serum, which is an important marker for blood clotting disorders. Additionally, this antibody has shown promising results in interfering with interferon signaling pathways. With its unique immobilization capabilities, the D-dimer antibody offers researchers a powerful tool for studying various biological processes and developing diagnostic tools for related conditions.</p>

<p>Phencyclidine antibody is a highly specialized inhibitor that targets the growth factor and acts as an anti-connexin agent. It is commonly used in Life Sciences, specifically in research related to helicobacter and chemokine. This antibody is available in both polyclonal and monoclonal forms, providing researchers with versatile options for their experiments. The colloidal microsphere formulation ensures efficient binding to the target molecules, enhancing the accuracy of experimental results. Additionally, this antibody has demonstrated efficacy in inhibiting telomerase activity and phosphorylcholine signaling pathways. Researchers can also utilize this antibody as a substrate for siRNA delivery or as an endothelial growth factor in cell culture studies. With its wide range of applications, the Phencyclidine antibody is a valuable tool for researchers in various fields of study.</p>

<p>The SHH antibody is a monoclonal antibody that specifically targets the Sonic Hedgehog (SHH) protein isoforms. It has been extensively studied in the field of Life Sciences and has shown promising results in various applications. The SHH antibody can be used in research studies to investigate the role of SHH in development, cell signaling, and disease processes.</p>

<p>Calcyclin antibody was raised in Mouse using a purified recombinant fragment of calcyclin expressed in E. coli as the immunogen.</p>

<p>Mouse monoclonal SLFNL1 antibody</p>

<p>Rabbit polyclonal SLC4A4 antibody</p>

<p>Purified native Porcine Lactate Dehydrogenase protein</p>

<p>C2ORF47 antibody was raised using the middle region of C2Orf47 corresponding to a region with amino acids GASVFQVKLGNQNVETKQLLSASYEFQREFTQGVKPDWTIARIEHSKLLE</p>

<p>Rabbit polyclonal OR13C3 antibody</p>

<p>The DUSP1 antibody is an antigen binding molecule used in Life Sciences research. It is commonly used to study the biological effects of epidermal growth factor (EGF), parathyroid hormone-related peptide (PTHrP), and hepatocyte growth factor (HGF). The DUSP1 antibody has been shown to inhibit cell proliferation and promote apoptosis in various cell types. Additionally, it has been used to measure microvessel density in isolated retinal tissue and to study the role of taurine in human serum. The DUSP1 antibody is available as both a polyclonal antibody and a mouse monoclonal antibody, providing researchers with options for their specific experimental needs.</p>

<p>Rabbit polyclonal CNGA1 antibody</p>

<p>BAG3 antibody was raised in Rabbit using Human BAG3 as the immunogen</p>

<p>ABCE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LAGMNKFLSQLEITFRRDPNNYRPRINKLNSIKDVEQKKSGNYFFLDD</p>

<p>ZNF286 antibody was raised in rabbit using the C terminal of ZNF286 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PDHA1 antibody, catalog no. 70R-1094</p>

PARP6 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLPLSRLKFMHTSHQFLLLSSPPAKEARFRTAKKLYGSTFAFHGSHIENW

<p>Rabbit polyclonal argF antibody</p>

<p>TXNDC15 antibody was raised using the C terminal of TXNDC15 corresponding to a region with amino acids STRFGTVAVPNILLFQGAKPMARFNHTDRTLETLKIFIFNQTGIEAKKNV</p>

<p>Cacng1 antibody was raised in rabbit using the N terminal of Cacng1 as the immunogen</p>

<p>Rat monoclonal IgM antibody (PE)</p>

<p>Inhibitor of CDK2/CDK9 kinases</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HERC6 antibody, catalog no. 70R-2770</p>

<p>Mouse Monoclonal KRT20 antibody</p>

<p>PSMD8 antibody was raised using a synthetic peptide corresponding to a region with amino acids DYAKKRGWVLGPNNYYSFASQQQKPEDTTIPSTELAKQVIEYARQLEMIV</p>

<p>This antibody reacts with heavy chains on human IgG (gamma chain) and light chains on all human immunoglobulins.</p>

<p>EGF antibody was raised in goat using highly pure recombinant murine EGF as the immunogen.</p>

<p>Purified Rabbit polyclonal Bcr antibody (Tyr177)</p>

<p>The GPR20 antibody is a highly effective antibody-drug that belongs to the class of antibodies. It is specifically designed to target and bind to GPR20, a protein receptor involved in various biological processes. This monoclonal antibody has been extensively studied and proven to have high specificity and affinity for GPR20.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of U2AF1 antibody, catalog no. 70R-4817</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PRDM13 antibody, catalog no. 20R-1222</p>

<p>Estriol protein is a monoclonal antibody that interacts with chemokines and glycoproteins to inhibit their activity. It is commonly used in the field of Life Sciences for research purposes. Estriol protein has been shown to have cytotoxic effects on certain cancer cells by inhibiting the growth factors necessary for their survival. Additionally, it has been found to interact with interferon and androgen receptors, which play important roles in various biological processes. This recombinant protein can also bind to collagen and other binding proteins, making it a versatile tool for studying protein-protein interactions.</p>

<p>Plakophilin 3 Monoclonal Antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of G6pc antibody, catalog no. 70R-8595</p>

<p>Mouse monoclonal RPN1 antibody</p>

<p>Recombinant human RGS17 protein</p>

<p>RPIA antibody was raised using a synthetic peptide corresponding to a region with amino acids MQRPGPFSTLYGRVLAPLPGRAGGAASGGGGNSWDLPGSHVRLPGRAQSG</p>

<p>Mouse monoclonal TPMT antibody</p>

<p>Milk Fat Globulin Protein E8 Monoclonal Antibody</p>

<p>The INPP5B antibody is a highly effective substance used in the field of Life Sciences. It belongs to the class of Polyclonal Antibodies and is widely used as a test substance in various research applications. This antibody specifically targets INPP5B, an enzyme involved in the metabolism of inositol phosphates. By inhibiting the activity of INPP5B, this antibody can modulate cellular signaling pathways and provide valuable insights into various cellular processes.</p>

<p>Mouse monoclonal CHCHD5 antibody</p>

A synthetic peptide for use as a blocking control in assays to test for specificity of LRP1 antibody, catalog no. 70R-2480

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CXorf20 antibody, catalog no. 70R-4186</p>

<p>Rabbit polyclonal RPL11 antibody (FITC)</p>

<p>Rabbit polyclonal SMAD2 antibody (Ser467)</p>

<p>The TRAF6 antibody is a highly specialized protein that specifically targets TNF-α, a key cytokine involved in inflammation and immune response. By binding to TNF-α, the TRAF6 antibody inhibits its activity and reduces the inflammatory response in the body. This has been shown to have beneficial effects on various conditions related to excessive inflammation, such as autoimmune diseases and chronic inflammatory disorders.</p>

<p>Rabbit Polyclonal alpha Synuclein antibody (Tyr125)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of AKR1B1 antibody, catalog no. 70R-2252</p>

<p>The Tau antibody is a polyclonal antibody that is used in Life Sciences research. It specifically targets and binds to the tau protein, which plays a crucial role in the development of neurodegenerative diseases such as Alzheimer's disease. The antibody can be used for various applications, including immunohistochemistry, Western blotting, and ELISA assays.</p>

<p>FOXM1 antibody was raised in rabbit using the middle region of FOXM1 as the immunogen</p>

<p>CXCL16 antibody was raised using a synthetic peptide corresponding to a region with amino acids TARTSATVPVLCLLAIIFILTAALSYVLCKRRRGQSPQSSPDLPVHYIPV</p>

<p>Mouse monoclonal Cytokeratin 6 antibody</p>

<p>The CYP2E1 antibody is a monoclonal antibody used in life sciences research. It specifically targets the CYP2E1 enzyme, which is primarily found in the liver microsomes. This antibody has been widely used to study the role of CYP2E1 in various physiological processes, including drug metabolism, alcohol metabolism, and oxidative stress. It can be used for immunohistochemistry, western blotting, and other molecular biology techniques to detect and quantify the expression levels of CYP2E1 in different tissues and cell types. The CYP2E1 antibody is highly specific and sensitive, making it an essential tool for researchers studying the function and regulation of this important enzyme.</p>

<p>hCG beta antibody (HRP) was raised in mouse using hCG beta as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LYZ antibody, catalog no. 70R-10029</p>

SDHB antibody was raised using a synthetic peptide corresponding to a region with amino acids YRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAE

<p>RPS13 antibody was raised using the middle region of RPS13 corresponding to a region with amino acids ILRILKSKGLAPDLPEDLYHLIKKAVAVRKHLERNRKDKDAKFRLILIES</p>

<p>SARS antibody was raised using the C terminal of SARS corresponding to a region with amino acids PEKLKEFMPPGLQELIPFVKPAPIEQEPSKKQKKQHEGSKKKAAARDVTL</p>

<p>The GLUT5 antibody is a highly effective and versatile tool used in various scientific and medical research applications. This monoclonal antibody specifically targets the GLUT5 protein, which plays a crucial role in the transportation of fructose across cell membranes.</p>